Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T42440
(Former ID: TTDI02667)
|
|||||
Target Name |
Hepcidin messenger RNA (HAMP mRNA)
|
|||||
Synonyms |
UNQ487/PRO1003 (mRNA); Putative liver tumor regressor (mRNA); PLTR (mRNA); Liver-expressed antimicrobial peptide 1 (mRNA); LEAP1 (mRNA); LEAP-1 (mRNA); Hepcidin (mRNA); HEPC (mRNA)
Click to Show/Hide
|
|||||
Gene Name |
HAMP
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
Acts by promoting endocytosis and degradation of ferroportin, leading to the retention of iron in iron-exporting cells and decreased flow of iron into plasma. Controls the major flows of iron into plasma: absorption of dietary iron in the intestine, recycling of iron by macrophages, which phagocytose old erythrocytes and other cells, and mobilization of stored iron from hepatocytes. Liver-produced hormone that constitutes the main circulating regulator of iron absorption and distribution across tissues.
Click to Show/Hide
|
|||||
BioChemical Class |
mRNA target
|
|||||
UniProt ID | ||||||
Sequence |
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRD
THFPICIFCCGCCHRSKCGMCCKT Click to Show/Hide
|
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Smad1/5 is required for erythropoietin-mediated suppression of hepcidin in mice. Blood. 2017 Jul 6;130(1):73-83. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.