Target Information

Target General Information

Target ID

T40010 (Former ID: TTDC00238)

Target Name

Epidermal growth factor-like protein 7 (EGFL7)

Synonyms

ZNEU1; Vascular endothelial statin; VE-statin; UNQ187/PRO1449; NOTCH4-like protein; Multiple epidermal growth factor-like domains protein 7; Multiple epidermal growth factor-like domain protein 7; Multiple EGF-like domains protein 7; Multiple EGF-like domain protein 7; MEGF7; EGF-like protein 7

Click to Show/Hide

Gene Name

EGFL7

Target Type

Clinical trial target

[1]

Disease

[+] 2 Target-related Diseases

Colorectal cancer [ICD-11: 2B91]

Lung cancer [ICD-11: 2C25]

Function

Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cell adhesion to the extracellular matrix and angiogenesis. Regulates vascular tubulogenesis in vivo.

Click to Show/Hide

BioChemical Class

Growth factor

UniProt ID

EGFL7_HUMAN

Sequence

MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHR
ACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQP
GRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKG
GPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLL
VHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Drugs and Modes of Action

Top

Clinical Trial Drug(s)

[+] 2 Clinical Trial Drugs

MEGF0444A

Drug Info

Phase 2

Non-small-cell lung cancer

[2]

Anti-EGFL7

Drug Info

Phase 1

Non-small-cell lung cancer

[3]

Discontinued Drug(s)

[+] 1 Discontinued Drugs

RG7414

Drug Info

Discontinued in Phase 2

Non-small-cell lung cancer

[4]

Mode of Action

[+] 1 Modes of Action

Modulator

[+] 2 Modulator drugs

MEGF0444A

Drug Info

[1]

RG7414

Drug Info

[6]

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues. The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021). Human Similarity Proteins Human Tissue Distribution

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.

The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021).

Human Similarity Proteins

Human Tissue Distribution

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Protocadherin Fat 1 (FAT1)	PF00028 ; PF00008 ; PF02210 More >>	47.368 (27/57)	1.61E-11
Protocadherin Fat 3 (FAT3)	PF00028 ; PF02210	40.404 (40/99)	8.11E-09
Coagulation factor IX (F9)	PF00008 ; PF14670 ; PF00594 ; PF00089 More >>	39.726 (29/73)	9.81E-08
Coagulation factor VII (F7)	PF00008 ; PF00594 ; PF00089 More >>	40.789 (31/76)	1.20E-07
Endosialin (CD248)	PF14670 ; PF00059	40.476 (34/84)	2.04E-06
von Willebrand factor D and EGF domain-containing protein (VWDE)	PF00094	35.802 (29/81)	4.37E-06
Delta-like protein 3 (DLL3)	PF00008 ; PF12661 ; PF07657 More >>	42.623 (26/61)	4.74E-06
Sushi, nidogen and EGF-like domain-containing protein 1 (SNED1)	PF00008 ; PF00041 ; PF12661 ; PF06119 More >>	48.387 (30/62)	7.73E-06
Cadherin EGF LAG seven-pass G-type receptor 2 (CELSR2)	PF00002 ; PF00028 ; PF00008 ; PF16489 ; PF01825 ; PF12661 ; PF00053 ; PF02210 More >>	44.681 (21/47)	7.96E-06
Cadherin EGF LAG seven-pass G-type receptor 1 (CELSR1)	PF00002 ; PF00028 ; PF00008 ; PF16489 ; PF01825 ; PF02793 ; PF00053 ; PF02210 More >>	40.426 (19/47)	8.12E-06
Vitamin K-dependent protein Z (PROZ)	PF00008 ; PF14670 ; PF00594 ; PF00089 More >>	32.967 (30/91)	9.08E-06
Hedgehog-interacting protein (HHIP)	PF03024 ; PF07995	34.286 (24/70)	1.99E-05
Coagulation factor Xa (F10)	PF00008 ; PF14670 ; PF00594 ; PF00089 More >>	33.333 (26/78)	2.32E-05
Oncoprotein-induced transcript 3 protein (OIT3)	PF14670 ; PF00100	39.189 (29/74)	2.48E-05
Multiple epidermal growth factor-like domains protein 10 (MEGF10)	PF12661 ; PF00053	31.132 (33/106)	4.37E-05
Versican core protein (VCAN)	PF00008 ; PF00059 ; PF00084 ; PF07686 ; PF00193 More >>	32.857 (23/70)	6.92E-05
Protein delta homolog 1 (DLK1)	PF00008	33.981 (35/103)	8.52E-05
Multiple epidermal growth factor-like domains protein 11 (MEGF11)	PF12661 ; PF00053	34.286 (36/105)	8.57E-05
Matrilin-3 (MATN3)	PF14670 ; PF10393 ; PF00092 More >>	34.940 (29/83)	1.31E-04
Protein eyes shut homolog (EYS)	PF00008 ; PF12661 ; PF00054 ; PF02210 More >>	34.667 (26/75)	1.59E-04
Slit homolog 1 protein (SLIT1)	PF00008 ; PF12661 ; PF02210 ; PF13855 ; PF01463 ; PF01462 More >>	33.708 (30/89)	1.81E-04
Vitamin K-dependent protein C (PROC)	PF00008 ; PF14670 ; PF00594 ; PF00089 More >>	29.358 (32/109)	2.38E-04
Protein crumbs homolog 2 (CRB2)	PF00008 ; PF12661 ; PF02210 More >>	38.356 (28/73)	2.49E-04
Delta-like protein 1 (DLL1)	PF01414 ; PF00008 ; PF12661 ; PF07657 More >>	36.508 (23/63)	2.67E-04
Slit homolog 2 protein (SLIT2)	PF00008 ; PF12661 ; PF00054 ; PF13855 ; PF01463 ; PF01462 More >>	28.409 (25/88)	3.03E-04
Teneurin-2 (TENM2)	PF06484 ; PF15636	30.588 (26/85)	4.91E-04
Low-density lipoprotein receptor-related protein 4 (LRP4)	PF12662 ; PF14670 ; PF00057 ; PF00058 More >>	37.805 (31/82)	5.20E-04
Wnt inhibitory factor 1 (WIF1)	PF12661 ; PF02019	35.593 (21/59)	5.30E-04
Stabilin-2 (STAB2)	PF12947 ; PF02469 ; PF00193 More >>	32.979 (31/94)	8.38E-04
Platelet endothelial aggregation receptor 1 (PEAR1)	PF00053	34.146 (28/82)	1.00E-03
Protein crumbs homolog 1 (CRB1)	PF00008 ; PF12661 ; PF02210 More >>	26.852 (29/108)	1.00E-03
Cartilage matrix protein (MATN1)	PF14670 ; PF10393 ; PF00092 More >>	42.105 (16/38)	2.00E-03
Cadherin EGF LAG seven-pass G-type receptor 3 (CELSR3)	PF00002 ; PF00028 ; PF00008 ; PF16489 ; PF01825 ; PF00053 ; PF02210 More >>	36.709 (29/79)	3.00E-03
Delta and Notch-like epidermal growth factor-related receptor (DNER)	PF19330 ; PF00008 ; PF12661 More >>	34.483 (30/87)	3.00E-03
Slit homolog 3 protein (SLIT3)	PF00008 ; PF12661 ; PF02210 ; PF13855 ; PF01463 ; PF01462 More >>	36.957 (17/46)	4.00E-03
Click to Show/Hide the Information of Human Similarity Proteins


Note: If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.

Target Regulators

Top

Target-regulating microRNAs

Target-regulating microRNAs Info

Target Profiles in Patients

Top

Target Expression
Profile (TEP)

Target Expression Profile Info

Target-Related Models and Studies

Top

Target Validation

Target Validation Info

References

Top

REF 1

A first-in-human phase Ia open-label dose-escalation study of the safety, pharmacokinetics (PK), and pharmacodynamics (PD) of the humanized monoclonal antibody (huMAb) anti-EGFL7 (MEGF0444A) administered intravenously in patients with advanced solid tumors. J Clin Oncol (Meeting Abstracts) May 2011 vol.29 no.15_suppl 2614.

REF 2

ClinicalTrials.gov (NCT00909740) A Study of the Safety and Pharmacokinetics of MEGF0444A Administered to Patients With Advanced Solid Tumors. U.S. National Institutes of Health.

REF 3

Clinical pipeline report, company report or official report of Genentech (2011).

REF 4

Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800030998)

REF 5

Clinical pipeline report, company report or official report of Genentech (2009).

REF 6

Anti-EGFL7 antibodies enhance stress-induced endothelial cell death and anti-VEGF efficacy. J Clin Invest. 2013 September 3; 123(9): 3997-4009.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN