Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T37539
(Former ID: TTDS00480)
|
|||||
| Target Name |
B-cell receptor CD22 (CD22)
|
|||||
| Synonyms |
T-cell surface antigen Leu-14; Siglec-2; Sialic acid-binding Ig-like lectin 2; SIGLEC2; Leu-14; BL-CAM; B-lymphocyte cell adhesion molecule
Click to Show/Hide
|
|||||
| Gene Name |
CD22
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 4 Target-related Diseases | + | ||||
| 1 | Lyme borreliosis [ICD-11: 1C1G] | |||||
| 2 | Malignant haematopoietic neoplasm [ICD-11: 2B33] | |||||
| 3 | Mature B-cell leukaemia [ICD-11: 2A82] | |||||
| 4 | Mature B-cell lymphoma [ICD-11: 2A85] | |||||
| Function |
May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules. Mediates B-cell B-cell interactions.
Click to Show/Hide
|
|||||
| BioChemical Class |
Immunoglobulin
|
|||||
| UniProt ID | ||||||
| Sequence |
MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFH
NPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLR MESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEG VPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKH TPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVT KDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPL PTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK KVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNT TIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQ FFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSM SPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQ GTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQG LQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMNIPRTGDAES SEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENV DYVILKH Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 3 Approved Drugs | + | ||||
| 1 | Inotuzumab ozogamicin | Drug Info | Approved | Acute lymphocytic leukaemia | [2] | |
| 2 | Moxetumomab pasudotox | Drug Info | Approved | Hairy cell leukaemia | [3] | |
| 3 | OspA lipoprotein | Drug Info | Approved | Lyme disease | [4] | |
| Clinical Trial Drug(s) | [+] 37 Clinical Trial Drugs | + | ||||
| 1 | Epratuzumab | Drug Info | Phase 3 | Graft rejection in heart transplantation | [5], [6] | |
| 2 | BL-22 | Drug Info | Phase 2 | Acute lymphoblastic leukaemia | [7] | |
| 3 | CAR-T cells targeting CD22 | Drug Info | Phase 2 | Non-hodgkin lymphoma | [8] | |
| 4 | 4SCAR19 and 4SCAR22 | Drug Info | Phase 1/2 | B-cell lymphoma | [9] | |
| 5 | 4SCAR19/22 T cells | Drug Info | Phase 1/2 | B-cell lymphoma | [10] | |
| 6 | Anti-CD19/22-CAR vector-transduced T cells | Drug Info | Phase 1/2 | Acute lymphoblastic leukaemia | [11] | |
| 7 | Anti-CD22 CAR-T cells | Drug Info | Phase 1/2 | leukaemia | [12] | |
| 8 | Anti-CD22-CAR-transduced T cells | Drug Info | Phase 1/2 | leukaemia | [13] | |
| 9 | AUTO3 | Drug Info | Phase 1/2 | Acute lymphoblastic leukaemia | [14] | |
| 10 | CAR-T cells targeting CD22 | Drug Info | Phase 1/2 | leukaemia | [15] | |
| 11 | CART-19/22 | Drug Info | Phase 1/2 | leukaemia | [16] | |
| 12 | CD19 and CD22 CAR-T Cells | Drug Info | Phase 1/2 | Lymphoma | [17] | |
| 13 | CD19 and CD22 CAR-T Cells | Drug Info | Phase 1/2 | B-cell lymphoma | [18] | |
| 14 | CD19-TCRz-41BB and CD22-TCRz-41BB CAR-T Cells | Drug Info | Phase 1/2 | Haematopoietic/lymphoid cancer | [19] | |
| 15 | CD22 CAR-T | Drug Info | Phase 1/2 | B-cell lymphoma | [20] | |
| 16 | CD22-Targeted CAR-T cells | Drug Info | Phase 1/2 | leukaemia | [21] | |
| 17 | Anti-CD22 | Drug Info | Phase 1 | Haematological malignancy | [22] | |
| 18 | Anti-CD22 CAR-T cells | Drug Info | Phase 1 | leukaemia | [23] | |
| 19 | CART-22 cells | Drug Info | Phase 1 | Acute lymphoblastic leukaemia | [24] | |
| 20 | CART22 cells | Drug Info | Phase 1 | Acute lymphoblastic leukaemia | [25] | |
| 21 | CART22 cells expressing anti-CD22 scFv TCRz:41BB | Drug Info | Phase 1 | Acute lymphoblastic leukaemia | [26] | |
| 22 | CART22-65s cells | Drug Info | Phase 1 | Acute lymphoblastic leukaemia | [27] | |
| 23 | CART22-65s cells and huCART19 Cells | Drug Info | Phase 1 | Acute lymphoblastic leukaemia | [27] | |
| 24 | CD19/CD22 CAR T cells | Drug Info | Phase 1 | Acute lymphoblastic leukaemia | [28] | |
| 25 | CD19/CD22 CAR T-Cells | Drug Info | Phase 1 | Acute lymphocytic leukaemia | [29] | |
| 26 | CD19/CD22 Chimeric Antigen Receptor T Cells | Drug Info | Phase 1 | Acute lymphoblastic leukaemia | [30] | |
| 27 | CD22-CART | Drug Info | Phase 1 | leukaemia | [31] | |
| 28 | CD22-specific CAR T-cells also expressing an EGFRt | Drug Info | Phase 1 | leukaemia | [32] | |
| 29 | Combotox | Drug Info | Phase 1 | leukaemia | [33] | |
| 30 | Donor-derived CD19/22 bispecific CAR-T cells | Drug Info | Phase 1 | leukaemia | [34] | |
| 31 | JCAR018 | Drug Info | Phase 1 | Acute lymphoblastic leukaemia | [35] | |
| 32 | JNJ-75348780 | Drug Info | Phase 1 | Non-hodgkin lymphoma | [36] | |
| 33 | Lumoxiti | Drug Info | Phase 1 | Hairy cell leukaemia | [37] | |
| 34 | Patient-derived CD19- and CD22 specific CAR | Drug Info | Phase 1 | leukaemia | [38] | |
| 35 | Retroviral vector-transduced autologous T cells to express CD22-specific CARs | Drug Info | Phase 1 | Diffuse large B-cell lymphoma | [39] | |
| 36 | TRPH-222 | Drug Info | Phase 1 | Non-hodgkin lymphoma | [40] | |
| 37 | UCART-22 | Drug Info | Phase 1 | B-cell acute lymphoblastic leukaemia | [41] | |
| Discontinued Drug(s) | [+] 2 Discontinued Drugs | + | ||||
| 1 | DCDT-2980S | Drug Info | Discontinued in Phase 2 | Diffuse large B-cell lymphoma | [42] | |
| 2 | RG7593 | Drug Info | Discontinued in Phase 2 | Haematological malignancy | [42] | |
| Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
| 1 | ATA2431 | Drug Info | Preclinical | B-cell lymphoma | [43] | |
| Mode of Action | [+] 6 Modes of Action | + | ||||
| Modulator | [+] 4 Modulator drugs | + | ||||
| 1 | Moxetumomab pasudotox | Drug Info | [45] | |||
| 2 | Combotox | Drug Info | [48] | |||
| 3 | RG7593 | Drug Info | [53] | |||
| 4 | Anti-CD22/CD19 mab-toxin conjugate | Drug Info | [54] | |||
| Binder | [+] 1 Binder drugs | + | ||||
| 1 | OspA lipoprotein | Drug Info | [1] | |||
| CAR-T-Cell-Therapy | [+] 13 CAR-T-Cell-Therapy drugs | + | ||||
| 1 | CAR-T cells targeting CD22 | Drug Info | [8] | |||
| 2 | Anti-CD22 CAR-T cells | Drug Info | [12] | |||
| 3 | Anti-CD22-CAR-transduced T cells | Drug Info | [13] | |||
| 4 | CAR-T cells targeting CD22 | Drug Info | [15] | |||
| 5 | CD22 CAR-T | Drug Info | [20] | |||
| 6 | CD22-Targeted CAR-T cells | Drug Info | [21] | |||
| 7 | Anti-CD22 CAR-T cells | Drug Info | [23] | |||
| 8 | CART-22 cells | Drug Info | [24] | |||
| 9 | CART22 cells | Drug Info | [25] | |||
| 10 | CART22 cells expressing anti-CD22 scFv TCRz:41BB | Drug Info | [26] | |||
| 11 | CART22-65s cells | Drug Info | [27] | |||
| 12 | CD22-specific CAR T-cells also expressing an EGFRt | Drug Info | [32] | |||
| 13 | Retroviral vector-transduced autologous T cells to express CD22-specific CARs | Drug Info | [39] | |||
| CAR-T-Cell-Therapy(Dual specific) | [+] 15 CAR-T-Cell-Therapy(Dual specific) drugs | + | ||||
| 1 | 4SCAR19 and 4SCAR22 | Drug Info | [9] | |||
| 2 | 4SCAR19/22 T cells | Drug Info | [10] | |||
| 3 | Anti-CD19/22-CAR vector-transduced T cells | Drug Info | [11] | |||
| 4 | AUTO3 | Drug Info | [14], [47] | |||
| 5 | CART-19/22 | Drug Info | [16] | |||
| 6 | CD19 and CD22 CAR-T Cells | Drug Info | [17] | |||
| 7 | CD19 and CD22 CAR-T Cells | Drug Info | [18] | |||
| 8 | CD19-TCRz-41BB and CD22-TCRz-41BB CAR-T Cells | Drug Info | [19] | |||
| 9 | CART22-65s cells and huCART19 Cells | Drug Info | [27] | |||
| 10 | CD19/CD22 CAR T cells | Drug Info | [28] | |||
| 11 | CD19/CD22 CAR T-Cells | Drug Info | [29] | |||
| 12 | CD19/CD22 Chimeric Antigen Receptor T Cells | Drug Info | [30] | |||
| 13 | CD22-CART | Drug Info | [31] | |||
| 14 | Donor-derived CD19/22 bispecific CAR-T cells | Drug Info | [34] | |||
| 15 | Patient-derived CD19- and CD22 specific CAR | Drug Info | [38] | |||
| Immunomodulator | [+] 1 Immunomodulator drugs | + | ||||
| 1 | JCAR018 | Drug Info | [35] | |||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | Lumoxiti | Drug Info | [49] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Tissue Distribution
Human Pathway Affiliation
Biological Network Descriptors
|
|
|
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
| KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
|---|---|---|---|
| Cell adhesion molecules | hsa04514 | Affiliated Target |
|
| Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
| Hematopoietic cell lineage | hsa04640 | Affiliated Target |
|
| Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
| B cell receptor signaling pathway | hsa04662 | Affiliated Target |
|
| Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
| Degree | 8 | Degree centrality | 8.59E-04 | Betweenness centrality | 1.41E-05 |
|---|---|---|---|---|---|
| Closeness centrality | 2.24E-01 | Radiality | 1.39E+01 | Clustering coefficient | 6.07E-01 |
| Neighborhood connectivity | 4.36E+01 | Topological coefficient | 1.94E-01 | Eccentricity | 11 |
| Download | Click to Download the Full PPI Network of This Target | ||||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| Target-interacting Proteins | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
| 1 | Cell adhesion molecules (CAMs) | |||||
| 2 | Hematopoietic cell lineage | |||||
| 3 | B cell receptor signaling pathway | |||||
| Panther Pathway | [+] 1 Panther Pathways | + | ||||
| 1 | B cell activation | |||||
| PID Pathway | [+] 1 PID Pathways | + | ||||
| 1 | BCR signaling pathway | |||||
| Reactome | [+] 2 Reactome Pathways | + | ||||
| 1 | Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell | |||||
| 2 | Antigen activates B Cell Receptor (BCR) leading to generation of second messengers | |||||
| WikiPathways | [+] 1 WikiPathways | + | ||||
| 1 | B Cell Receptor Signaling Pathway | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Safety and immunogenicity of recombinant Bacille Calmette-Gu |rin (rBCG) expressing Borrelia burgdorferi outer surface protein A (OspA) lipoprotein in adult volunteers: a candidate Lyme disease vaccine. Vaccine. 1999 Feb 26;17(7-8):904-14. | |||||
| REF 2 | 2017 FDA drug approvals.Nat Rev Drug Discov. 2018 Feb;17(2):81-85. | |||||
| REF 3 | FDA Approved Drug Products from FDA Official Website. 2018. Application Number: (ANDA) 761104. | |||||
| REF 4 | Infection of mice with lyme disease spirochetes constitutively producing outer surface proteins a and B. Infect Immun. 2007 Jun;75(6):2786-94. | |||||
| REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8088). | |||||
| REF 6 | New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21. | |||||
| REF 7 | ClinicalTrials.gov (NCT00924040) Retreatment Protocol for BL22 Immunotherapy in Relapsed or Refractory Hairy Cell Leukemia. U.S. National Institutes of Health. | |||||
| REF 8 | ClinicalTrials.gov (NCT03196830) CAR-T for R/R B-NHL | |||||
| REF 9 | ClinicalTrials.gov (NCT03125577) Combination CAR-T Cell Therapy Targeting Hematological Malignancies | |||||
| REF 10 | ClinicalTrials.gov (NCT03098355) Interleukin-2 Following 4SCAR19/22 T Cells Targeting Refractory and/or Recurrent B Cell Malignancies | |||||
| REF 11 | ClinicalTrials.gov (NCT03185494) Treatment of Relapsed and/or Chemotherapy Refractory B-cell Malignancy by Tandem CAR T Cells Targeting CD19 and CD22 | |||||
| REF 12 | ClinicalTrials.gov (NCT03638206) Autologous CAR-T/TCR-T Cell Immunotherapy for Malignancies | |||||
| REF 13 | ClinicalTrials.gov (NCT03262298) Anti-CD22 CAR-T Cell Therapy Targeting B Cell Malignancies | |||||
| REF 14 | ClinicalTrials.gov (NCT03289455) CD19 /22 CAR T Cells (AUTO3) for the Treatment of B Cell ALL | |||||
| REF 15 | ClinicalTrials.gov (NCT03312205) CAR-T Cells for Relapsed or Refractory Haematopoietic and Lymphoid Malignancies | |||||
| REF 16 | ClinicalTrials.gov (NCT03614858) CD19/CD22-targeted Chimeric Antigen Receptor Engineered T Cell (CART) in B-Cell Acute Lymphoblastic Leukemia. | |||||
| REF 17 | ClinicalTrials.gov (NCT03468153) Dual Specificity CD19 and CD22 CAR-T Cell Immunotherapy for CD19+CD22+ Relapsed and Refractory Lymphoma | |||||
| REF 18 | ClinicalTrials.gov (NCT03398967) A Feasibility and Safety Study of Universal Dual Specificity CD19 and CD20 or CD22 CAR-T Cell Immunotherapy for Relapsed or Refractory Leukemia and Lymphoma | |||||
| REF 19 | ClinicalTrials.gov (NCT02903810) Combination Transfer of CD19-TCRz-41BB and CD22-TCRz-41BB CAR-T Cells for B-cell Hematologic Malignancy | |||||
| REF 20 | ClinicalTrials.gov (NCT02794961) CD22 Targeting CAR-T Therapy Against B Cell Hematological Malignancies | |||||
| REF 21 | ClinicalTrials.gov (NCT02935153) A Clinical Research of CD22-Targeted CAR-T in B Cell Malignancies | |||||
| REF 22 | 2011 Pipeline of Seattle Genetics. | |||||
| REF 23 | ClinicalTrials.gov (NCT03121625) CAR-T Therapy in Relapsed or Refractory Haematopoietic and Lymphoid Malignancies | |||||
| REF 24 | ClinicalTrials.gov (NCT03291444) CAR-T Cells Combined With Peptide Specific Dendritic Cell in Relapsed/Refractory Leukemia/MDS | |||||
| REF 25 | ClinicalTrials.gov (NCT02588456) Pilot Study of Autologous Anti-CD22 Chimeric Antigen Receptor Redirected T Cells In Patients With Chemotherapy Resistant Or Refractory Acute Lymphoblastic Leukemia | |||||
| REF 26 | ClinicalTrials.gov (NCT02650414) CD22 Redirected Autologous T Cells for ALL | |||||
| REF 27 | ClinicalTrials.gov (NCT03620058) CART22 Alone or in Combination With huCART19 for ALL | |||||
| REF 28 | ClinicalTrials.gov (NCT03241940) CD19/CD22 Chimeric Antigen Receptor T Cells and Chemotherapy in Treating Children or Young Adults With Recurrent or Refractory CD19 Positive B Acute Lymphoblastic Leukemia | |||||
| REF 29 | ClinicalTrials.gov (NCT03448393) CD19/CD22 Chimeric Antigen Receptor (CAR) T Cells in Children and Young Adults With Recurrent or Refractory CD19/CD22-expressing B Cell Malignancies | |||||
| REF 30 | ClinicalTrials.gov (NCT03233854) CD19/CD22 Chimeric Antigen Receptor T Cells and Chemotherapy in Treating Patients With Recurrent or Refractory CD19 Positive Diffuse Large B-Cell Lymphoma or B Acute Lymphoblastic Leukemia | |||||
| REF 31 | ClinicalTrials.gov (NCT03407859) Sequential Treatment With CD20/CD22/CD10-CART After CD19-CART Treatment Base on MRD in Relapsed/Refractory B-ALL | |||||
| REF 32 | ClinicalTrials.gov (NCT03244306) A Phase 1 Study of CD22-CAR TCell Immunotherapy for CD22+ Leukemia and Lymphoma | |||||
| REF 33 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027936) | |||||
| REF 34 | ClinicalTrials.gov (NCT03463928) A Feasibility and Safety Study of Concomitant Therapy With Allo-CAR-T Cells and Allo-HSCT in Patients With Relapse or Refractory Leukemia | |||||
| REF 35 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
| REF 36 | ClinicalTrials.gov (NCT04540796) A Phase 1, First-in-Human, Dose Escalation Study of the JNJ-75348780 Bispecific Antibody Targeting CD3 and CD22 in Participants With NHL and CLL. U.S.National Institutes of Health. | |||||
| REF 37 | ClinicalTrials.gov (NCT03805932) Title: Moxetumomab Pasudotox-tdfk (Lumoxiti ) and Rituximab (Rituxan ) for Relapsed Hairy Cell Leukemia. U.S. National Institutes of Health. | |||||
| REF 38 | ClinicalTrials.gov (NCT03330691) A Feasibility and Safety Study of Dual Specificity CD19 and CD22 CAR-T Cell Immunotherapy for CD19+CD22+ Leukemia and Lymphoma | |||||
| REF 39 | ClinicalTrials.gov (NCT02721407) Anti-CD22 CAR-T Therapy for CD19-refractory or Resistant Lymphoma Patients | |||||
| REF 40 | ClinicalTrials.gov (NCT03682796) Study of TRPH-222 in Patients With Relapsed and/or Refractory B-Cell Lymphoma. U.S. National Institutes of Health. | |||||
| REF 41 | ClinicalTrials.gov (NCT04150497) Phase I Study of UCART22 in Patients With Relapsed or Refractory CD22+ B-cell Acute Lymphoblastic Leukemia (BALLI-01). U.S. National Institutes of Health. | |||||
| REF 42 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800027651) | |||||
| REF 43 | Clinical pipeline report, company report or official report of Atara Biotherapeutics. | |||||
| REF 44 | Results of inotuzumab ozogamicin, a CD22 monoclonal antibody, in refractory and relapsed acute lymphocytic leukemia. Cancer. 2013 Aug 1;119(15):2728-36. | |||||
| REF 45 | Antibody fusion proteins: anti-CD22 recombinant immunotoxin moxetumomab pasudotox. Clin Cancer Res. 2011 Oct 15;17(20):6398-405. | |||||
| REF 46 | Anti-CD22 immunotoxin RFB4(dsFv)-PE38 (BL22) for CD22-positive hematologic malignancies of childhood: preclinical studies and phase I clinical trial. Clin Cancer Res. 2010 Mar 15;16(6):1894-903. | |||||
| REF 47 | ClinicalTrials.gov (NCT03287817) CD19/22 CAR T Cells (AUTO3) for the Treatment of Diffuse Large B Cell Lymphoma | |||||
| REF 48 | A phase I study of a combination of anti-CD19 and anti-CD22 immunotoxins (Combotox) in adult patients with refractory B-lineage acute lymphoblastic leukaemia.Br J Haematol.2011 Aug;154(4):471-6. | |||||
| REF 49 | Clinical pipeline report, company report or official report of Innate Pharma. | |||||
| REF 50 | Clinical pipeline report, company report or official report of Triphase Accelerator. | |||||
| REF 51 | Clinical pipeline report, company report or official report of Cellectis. | |||||
| REF 52 | Efficacy and toxicity of a CD22-targeted antibody-saporin conjugate in a xenograft model of non-Hodgkin's lymphoma. Oncoimmunology. 2012 December 1; 1(9): 1469-1475. | |||||
| REF 53 | Clinical pipeline report, company report or official report of Roche. | |||||
| REF 54 | Immunotoxins against CD19 and CD22 are effective in killing precursor-B acute lymphoblastic leukemia cells in vitro. Leukemia. 2000 May;14(5):853-8. | |||||
| REF 55 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2786). | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.