Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T35303
(Former ID: TTDI02211)
|
|||||
Target Name |
Pancreatic hormone (PH)
|
|||||
Synonyms |
Pancreatic prohormone; Pancreatic polypeptide; Pancreatic icosapeptide; PPY; PP; PI; PH; Obinepitide
Click to Show/Hide
|
|||||
Gene Name |
PPY
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Obesity [ICD-11: 5B80-5B81] | |||||
Function |
The physiological role for the icosapeptide has notyet been elucidated.
Click to Show/Hide
|
|||||
BioChemical Class |
Neuropeptide Y
|
|||||
UniProt ID | ||||||
Sequence |
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY
Click to Show/Hide
|
|||||
HIT2.0 ID | T96QF8 |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | PP-1420 | Drug Info | Phase 1/2 | Obesity | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | PP-1420 | Drug Info | [1] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Human Similarity Proteins
Human Pathway Affiliation
|
There is no similarity protein (E value < 0.005) for this target
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
|
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | Peptide ligand-binding receptors | |||||
2 | G alpha (i) signalling events | |||||
WikiPathways | [+] 2 WikiPathways | + | ||||
1 | GPCR ligand binding | |||||
2 | GPCR downstream signaling |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Pharmacokinetics, adverse effects and tolerability of a novel analogue of human pancreatic polypeptide, PP 1420. Br J Clin Pharmacol. 2012 Feb;73(2):232-9. | |||||
REF 2 | ClinicalTrials.gov (NCT02221765) Safety, Tolerability and Efficacy Study of PP1420 in HV. U.S. National Institutes of Health. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.