Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T35194
(Former ID: TTDR00085)
|
|||||
Target Name |
Dual specificity protein phosphatase 1 (DUSP1)
|
|||||
Synonyms |
VH1; Protein-tyrosine phosphatase CL100; PTPN10; Mitogen-activated protein kinase phosphatase 1; MKP1; MKP-1; MAP kinase phosphatase-1; MAP kinase phosphatase 1; Dual specificity protein phosphatase hVH1; CL100
Click to Show/Hide
|
|||||
Gene Name |
DUSP1
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Lung cancer [ICD-11: 2C25] | |||||
Function |
Dual specificity phosphatase that dephosphorylates MAP kinase MAPK1/ERK2 on both 'Thr-183' and 'Tyr-185', regulating its activity during the meiotic cell cycle.
Click to Show/Hide
|
|||||
BioChemical Class |
Phosphoric monoester hydrolase
|
|||||
UniProt ID | ||||||
EC Number |
EC 3.1.3.16
|
|||||
Sequence |
MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFF LKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSP ITTSPSC Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
HIT2.0 ID | T92FAW |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | Avastin+/-Tarceva | Drug Info | Phase 3 | Non-small-cell lung cancer | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 4 Inhibitor drugs | + | ||||
1 | Avastin+/-Tarceva | Drug Info | [1] | |||
2 | 4-ethoxynaphthalene-1,2-dione | Drug Info | [1] | |||
3 | ADOCIAQUINONE B | Drug Info | [1] | |||
4 | Okadaic acid | Drug Info | [3] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Pathway Affiliation
Biological Network Descriptors
|
There is no similarity protein (E value < 0.005) for this target
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
MAPK signaling pathway | hsa04010 | Affiliated Target |
|
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Serotonergic synapse | hsa04726 | Affiliated Target |
|
Class: Organismal Systems => Nervous system | Pathway Hierarchy |
Degree | 8 | Degree centrality | 8.59E-04 | Betweenness centrality | 7.25E-06 |
---|---|---|---|---|---|
Closeness centrality | 2.27E-01 | Radiality | 1.40E+01 | Clustering coefficient | 3.21E-01 |
Neighborhood connectivity | 4.85E+01 | Topological coefficient | 2.28E-01 | Eccentricity | 11 |
Download | Click to Download the Full PPI Network of This Target | ||||
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
1 | MAPK signaling pathway | |||||
2 | Serotonergic synapse | |||||
NetPath Pathway | [+] 5 NetPath Pathways | + | ||||
1 | FSH Signaling Pathway | |||||
2 | IL2 Signaling Pathway | |||||
3 | EGFR1 Signaling Pathway | |||||
4 | Wnt Signaling Pathway | |||||
5 | TCR Signaling Pathway | |||||
PID Pathway | [+] 6 PID Pathways | + | ||||
1 | Fc-epsilon receptor I signaling in mast cells | |||||
2 | Regulation of p38-alpha and p38-beta | |||||
3 | Direct p53 effectors | |||||
4 | ErbB1 downstream signaling | |||||
5 | ATF-2 transcription factor network | |||||
6 | AP-1 transcription factor network | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | RAF-independent MAPK1/3 activation | |||||
2 | Negative regulation of MAPK pathway | |||||
WikiPathways | [+] 1 WikiPathways | + | ||||
1 | MAPK Signaling Pathway |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Bioactivities of simplified adociaquinone B and naphthoquinone derivatives against Cdc25B, MKP-1, and MKP-3 phosphatases. Bioorg Med Chem. 2009 Mar 15;17(6):2276-81. | |||||
REF 2 | Clinical pipeline report, company report or official report of Roche. | |||||
REF 3 | Inhibition of protein phosphatase 1 stimulates secretion of Alzheimer amyloid precursor protein. Mol Med. 1995 Jul;1(5):535-41. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.