Target Information

Target General Information

Target ID

T32720

Target Name

MHC class I NK cell receptor 2DS1 (CD158h)

Synonyms

MHC class I NK cell receptor Eb6 ActI; Killer cell immunoglobulin-like receptor 2DS1; CD158h; CD158 antigen-like family member H

Click to Show/Hide

Gene Name

KIR2DS1

Target Type

Clinical trial target

[1]

Disease

[+] 1 Target-related Diseases

Multiple myeloma [ICD-11: 2A83]

Function

Receptor on natural killer (NK) cells for some HLA-C alleles such as w6. Does not inhibit the activity of NK cells.

Click to Show/Hide

BioChemical Class

Immunoglobulin

UniProt ID

KI2S1_HUMAN

Sequence

MSLTVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGMFNDTLRLIGEHHDGVSKANFSISRMKQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGT
FQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQE
VSYA

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Drugs and Modes of Action

Top

Clinical Trial Drug(s)

[+] 1 Clinical Trial Drugs

IPH-2101

Drug Info

Phase 2

Multiple myeloma

[2]

Mode of Action

[+] 1 Modes of Action

Modulator

[+] 1 Modulator drugs

IPH-2101

Drug Info

[1], [3], [4]

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function. Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006). Human Similarity Proteins Human Pathway Affiliation

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.

Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006).

Human Similarity Proteins

Human Pathway Affiliation

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Leukocyte immunoglobulin-like receptor subfamily B member 3 (LILRB3)	PF13895	42.979 (101/235)	5.39E-44
Leukocyte immunoglobulin-like receptor B2 (LILRB2)	PF13895	40.244 (99/246)	1.79E-43
Leukocyte immunoglobulin-like receptor subfamily A member 5 (LILRA5)	PF13895	33.681 (97/288)	1.19E-38
Natural cytotoxic triggering receptor 1 (NCR1)		29.936 (94/314)	1.44E-34
Platelet glycoprotein VI (GP6)	PF13895	36.626 (89/243)	3.21E-31
Immunoglobulin alpha Fc receptor (FCAR)		33.659 (69/205)	4.37E-23
T-cell-interacting, activating receptor on myeloid cells protein 1 (TARM1)	PF13895	29.304 (80/273)	1.13E-17
Osteoclast-associated receptor (OSCAR)	PF13895	30.493 (68/223)	8.85E-16
Alpha-1B-glycoprotein (A1BG)	PF13895	26.374 (48/182)	1.24E-05
B7 homolog 3 (CD276)	PF13927 ; PF07686	23.346 (60/257)	2.32E-05
Fc receptor-like protein 6 (FCRL6)	PF13895 ; PF13927	29.825 (34/114)	2.72E-05
Leukocyte-associated Ig-like receptor 1 (LAIR1)	PF13895	28.866 (28/97)	2.70E-04
Leukocyte-associated immunoglobulin-like receptor 2 (LAIR2)	PF13895	26.613 (33/124)	2.89E-04
V-set and transmembrane domain-containing protein 1 (VSTM1)	PF13895	27.778 (40/144)	4.82E-04
Click to Show/Hide the Information of Human Similarity Proteins

KEGG Pathway	Pathway ID	Affiliated Target
Antigen processing and presentation	hsa04612	Affiliated Target
Class: Organismal Systems => Immune system	Pathway Hierarchy
Natural killer cell mediated cytotoxicity	hsa04650	Affiliated Target
Class: Organismal Systems => Immune system	Pathway Hierarchy

References

Top

REF 1

Daratumumab-mediated lysis of primary multiple myeloma cells is enhanced in combination with the human anti-KIR antibody IPH2102 and lenalidomide. Haematologica. 2015 Feb;100(2):263-8.

REF 2

ClinicalTrials.gov (NCT01222286) Study on the Anti-tumor Activity, Safety and Pharmacology of IPH2101 in Patients With Smoldering Multiple Myeloma. U.S. National Institutes of Health.

REF 3

IPH-2101, a fully human anti-NK-cell inhibitory receptor mAb for the potential treatment of hematological cancers. Curr Opin Mol Ther. 2010 Dec;12(6):724-33.

REF 4

A phase II trial of pan-KIR2D blockade with IPH2101 in smoldering multiple myeloma

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN