Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T31674
(Former ID: TTDR00640)
|
|||||
Target Name |
Plasmodium Fructose-bisphosphate aldolase (Malaria FBA)
|
|||||
Synonyms |
Fructose-bisphosphate aldolase; 41 kDa antigen
Click to Show/Hide
|
|||||
Gene Name |
Malaria FBA
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
Catalyzes carboncarbon bond formation (or cleavage). Participate in the metabolically important pathways of gluconeogenesis and glycolysis.
Click to Show/Hide
|
|||||
BioChemical Class |
Carbon-carbon lyase
|
|||||
UniProt ID | ||||||
Sequence |
MAHCTEYMNAPKKLPADVAEELATTAQKLVQAGKGILAADESTQTIKKRFDNIKLENTIE
NRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPMVNLLHNENIIPGIKVDKGLVN IPCTDEEKSTQGLDGLAERCKEYYKAGARFAKWRTVLVIDTAKGKPTDLSIHETAWGLAR YASICQQNRLVPIVEPEILADGPHSIEVCAVVTQKVLSCVFKALQENGVLLEGALLKPNM VTAGYECTAKTTTQDVGFLTVRTLRRTVPPALPGVVFLSGGQSEEEASVNLNSINALGPH PWALTFSYGRALQASVLNTWQGKKENVAKAREVLLQRAEANSLATYGKYKGGAGGENAGA SLYEKKYVY Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | N-Sulfonyl hydroxamate derivatives as inhibitors of class II fructose-1,6-diphosphate aldolase. Bioorg Med Chem Lett. 2005 Dec 15;15(24):5375-7. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.