Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T30397
(Former ID: TTDR01350)
|
|||||
Target Name |
Influenza M messenger RNA (Influenza M mRNA)
|
|||||
Synonyms |
Proton channel protein M2 (mRNA); Matrix protein 2 (mRNA); M (mRNA)
Click to Show/Hide
|
|||||
Gene Name |
Influenza M mRNA
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
After attaching to the cell surface, the virion enters the cell by endocytosis. Acidification of the endosome triggers M2 ion channel activity. The influx of protons into virion interior is believed to disrupt interactions between the viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, thereby freeing the viral genome from interaction with viral proteins and enabling RNA segments to migrate to the host cell nucleus, where influenza virus RNA transcription and replication occur. Also plays a role in viral proteins secretory pathway. Elevates the intravesicular pH of normally acidic compartments, such as trans-Golgi network, preventing newly formed hemagglutinin from premature switching to the fusion-active conformation. Forms a proton-selective ion channel that is necessary for the efficient release of the viral genome during virus entry.
Click to Show/Hide
|
|||||
BioChemical Class |
mRNA target
|
|||||
UniProt ID | ||||||
Sequence |
MSLLTEVETLTRNGWGCRCSDSSDPLVVAASIIGILHLILWILDRLFFKCIYRRFKYGLK
RGPSTEGVPESMREEYRQEQQNAVDVDDGHFVNIELE Click to Show/Hide
|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | US patent application no. 5,580,767, Inhibition of influenza viruses by antisense oligonucleotides. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.