Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T30028
(Former ID: TTDS00483)
|
|||||
| Target Name |
Vesicle-associated membrane protein (VAMP)
|
|||||
| Synonyms |
VAMP; Synaptobrevin; SYB
Click to Show/Hide
|
|||||
| Gene Name |
VAMP1; VAMP2
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Parkinsonism [ICD-11: 8A00] | |||||
| Function |
Involved in the targeting and/or fusion of transport vesicles to their target membrane.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQ
KLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT Click to Show/Hide
|
|||||
| HIT2.0 ID | T95M9K | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Botulinum Toxin Type B | Drug Info | Approved | Parkinson disease | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Binder | [+] 1 Binder drugs | + | ||||
| 1 | Botulinum Toxin Type B | Drug Info | [1], [3] | |||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Long-lasting benefits of botulinum toxin type B in Parkinson's disease-related drooling. J Neurol. 2009 Apr;256(4):563-7. | |||||
| REF 2 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
| REF 3 | Botulinum toxin type A and type B for sialorrhoea in Parkinson's disease: a case for switching therapy J Rehabil Med. 2008 Nov;40(10):882-3. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.