Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T29712
(Former ID: TTDI02554)
|
|||||
| Target Name |
Placenta specific protein 1 (PLAC1)
|
|||||
| Synonyms |
Placentaspecific protein 1; PLAC1
Click to Show/Hide
|
|||||
| Gene Name |
PLAC1
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Function |
May play a role in placental development.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MKVFKFIGLMILLTSAFSAGSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLG
CPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQK SPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQ AGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Placenta-specific protein 1: a potential key to many oncofetal-placental OB/GYN research questions. Obstet Gynecol Int. 2014;2014:678984. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.