Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T28869
(Former ID: TTDS00479)
|
|||||
| Target Name |
Bacterial Urease (Bact ureC)
|
|||||
| Synonyms |
Urease subunit alpha; Urea amidohydrolase subunit alpha
Click to Show/Hide
|
|||||
| Gene Name |
Bact ureC
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Urinary tract infection [ICD-11: GC08] | |||||
| Function |
Catalyzes the hydrolysis of urea, leading to the production of carbon dioxide and ammonia. Allows many soil bacteria to use urea as a nitrogen source. An important virulence factor that improves survival of pathogenic bacteria under acidic conditions within the host and can also cause direct damage to the host tissue due to ammonia, CO2 or alkali production.
Click to Show/Hide
|
|||||
| BioChemical Class |
Carbon-nitrogen hydrolase
|
|||||
| UniProt ID | ||||||
| Sequence |
MSNISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQM
LAADCVDLVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIA AEGKIVTAGGIDTHIHWICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRM LQAADSLPVNIGLLGKGNVSQPDALREQVAAGVIGLKIHEDWGATPAAIDCALTVADEMD IQVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTNP TLPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDVLHDLGAFSLTSSD SQAMGRVGEVILRTWQVAHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHE VGSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGAL GSARHHCRLTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQT YEVRVDGELITSEPADVLPMAQRYFLF Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Acetohydroxamic Acid | Drug Info | Approved | Urinary tract infection | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 6 Inhibitor drugs | + | ||||
| 1 | Acetohydroxamic Acid | Drug Info | [1], [3] | |||
| 2 | 1-cyclohexyl-1-isopropyl-3,3-dimethylselenourea | Drug Info | [4] | |||
| 3 | 3-(4-bromobenzyl)-1,1-dimethylselenourea | Drug Info | [4] | |||
| 4 | 3-(4-bromophenyl)-1,1-dimethylthiourea | Drug Info | [4] | |||
| 5 | 3-dodecyl-1,1-dimethylthiourea | Drug Info | [4] | |||
| 6 | N-glycylglycinehydroxamic acid | Drug Info | [5] | |||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Enzymatic, immunological and phylogenetic characterization of Brucella suis urease. BMC Microbiol. 2008 Jul 19;8:121. | |||||
| REF 2 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 018749. | |||||
| REF 3 | Amines and oximes derived from deoxybenzoins as Helicobacter pylori urease inhibitors. Eur J Med Chem. 2009 May;44(5):2246-51. | |||||
| REF 4 | Facile one-pot synthesis of thio and selenourea derivatives: a new class of potent urease inhibitors. Bioorg Med Chem Lett. 2007 Nov 15;17(22):6387-91. | |||||
| REF 5 | Design, synthesis, and evaluation of novel organophosphorus inhibitors of bacterial ureases. J Med Chem. 2008 Sep 25;51(18):5736-44. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.