Target Information

Target General Information

Top

Target ID

T28620 (Former ID: TTDNR00668)

Target Name

Epidermal growth factor-like protein 6 (EGFL6)

Synonyms

MAM and EGF domains-containing gene protein; EGFL6; EGF-like protein 6

Click to Show/Hide

Gene Name

EGFL6

Target Type

Literature-reported target

[1]

Function

May bind integrin alpha-8/beta-1 and play a role in hair follicle morphogenesis. Promotes matrix assembly.

Click to Show/Hide

BioChemical Class

Growth factor

UniProt ID

EGFL6_HUMAN

Sequence

MPLPWSLALPLLLSWVAGGFGNAASARHHGLLASARQPGVCHYGTKLACCYGWRRNSKGV
CEATCEPGCKFGECVGPNKCRCFPGYTGKTCSQDVNECGMKPRPCQHRCVNTHGSYKCFC
LSGHMLMPDATCVNSRTCAMINCQYSCEDTEEGPQCLCPSSGLRLAPNGRDCLDIDECAS
GKVICPYNRRCVNTFGSYYCKCHIGFELQYISGRYDCIDINECTMDSHTCSHHANCFNTQ
GSFKCKCKQGYKGNGLRCSAIPENSVKEVLRAPGTIKDRIKKLLAHKNSMKKKAKIKNVT
PEPTRTPTPKVNLQPFNYEEIVSRGGNSHGGKKGNEEKMKEGLEDEKREEKALKNDIEER
SLRGDVFFPKVNEAGEFGLILVQRKALTSKLEHKDLNISVDCSFNHGICDWKQDREDDFD
WNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRV
FVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLLV
SGLCPDSLLSVDD

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Similarity Proteins

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Similarity Proteins

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Matrilin-4 (MATN4)	PF12662 ; PF14670 ; PF10393 ; PF00092 More >>	36.697 (40/109)	1.76E-13
Delta-like protein 1 (DLL1)	PF01414 ; PF00008 ; PF12661 ; PF07657 More >>	30.457 (60/197)	8.32E-11
Protocadherin Fat 1 (FAT1)	PF00028 ; PF00008 ; PF02210 More >>	33.099 (47/142)	1.60E-10
Delta and Notch-like epidermal growth factor-related receptor (DNER)	PF19330 ; PF00008 ; PF12661 More >>	31.351 (58/185)	2.65E-09
Protein eyes shut homolog (EYS)	PF00008 ; PF12661 ; PF00054 ; PF02210 More >>	31.839 (71/223)	9.75E-09
Protein crumbs homolog 2 (CRB2)	PF00008 ; PF12661 ; PF02210 More >>	28.713 (58/202)	1.56E-08
Matrilin-3 (MATN3)	PF14670 ; PF10393 ; PF00092 More >>	34.965 (50/143)	2.47E-08
Sushi, nidogen and EGF-like domain-containing protein 1 (SNED1)	PF00008 ; PF00041 ; PF12661 ; PF06119 More >>	28.729 (52/181)	9.91E-08
Slit homolog 3 protein (SLIT3)	PF00008 ; PF12661 ; PF02210 ; PF13855 ; PF01463 ; PF01462 More >>	26.415 (70/265)	1.66E-07
Delta-like protein 4 (DLL4)	PF01414 ; PF00008 ; PF07657 More >>	27.132 (70/258)	1.92E-07
Protein crumbs homolog 1 (CRB1)	PF00008 ; PF12661 ; PF02210 More >>	29.213 (52/178)	2.18E-07
Oncoprotein-induced transcript 3 protein (OIT3)	PF14670 ; PF00100	34.375 (44/128)	2.25E-07
Protein delta homolog 2 (DLK2)	PF00008 ; PF12661	28.431 (58/204)	7.84E-07
Protein delta homolog 1 (DLK1)	PF00008	27.711 (69/249)	4.05E-06
Stabilin-1 (STAB1)	PF12947 ; PF02469 ; PF00193 More >>	26.368 (53/201)	8.45E-06
Slit homolog 1 protein (SLIT1)	PF00008 ; PF12661 ; PF02210 ; PF13855 ; PF01463 ; PF01462 More >>	25.698 (46/179)	1.95E-05
Low-density lipoprotein receptor-related protein 4 (LRP4)	PF12662 ; PF14670 ; PF00057 ; PF00058 More >>	28.750 (46/160)	2.14E-05
Stabilin-2 (STAB2)	PF12947 ; PF02469 ; PF00193 More >>	25.475 (67/263)	4.13E-05
Tenascin-X (TNXB)	PF07974 ; PF18720 ; PF00147 ; PF00041 More >>	28.017 (65/232)	9.69E-05
Versican core protein (VCAN)	PF00008 ; PF00059 ; PF00084 ; PF07686 ; PF00193 More >>	30.986 (22/71)	1.11E-04
von Willebrand factor D and EGF domain-containing protein (VWDE)	PF00094	36.735 (36/98)	1.56E-04
Endosialin (CD248)	PF14670 ; PF00059	30.328 (37/122)	2.14E-04
Delta-like protein 3 (DLL3)	PF00008 ; PF12661 ; PF07657 More >>	23.554 (57/242)	3.29E-04
Low-density lipoprotein receptor-related protein 8 (LRP8)	PF14670 ; PF00057 ; PF00058 More >>	27.128 (51/188)	3.29E-04
Cadherin EGF LAG seven-pass G-type receptor 2 (CELSR2)	PF00002 ; PF00028 ; PF00008 ; PF16489 ; PF01825 ; PF12661 ; PF00053 ; PF02210 More >>	40.000 (20/50)	3.69E-04
Slit homolog 2 protein (SLIT2)	PF00008 ; PF12661 ; PF00054 ; PF13855 ; PF01463 ; PF01462 More >>	26.241 (37/141)	3.91E-04
Platelet endothelial aggregation receptor 1 (PEAR1)	PF00053	42.000 (21/50)	4.62E-04
Vitamin K-dependent protein Z (PROZ)	PF00008 ; PF14670 ; PF00594 ; PF00089 More >>	35.870 (33/92)	5.74E-04
Cadherin EGF LAG seven-pass G-type receptor 3 (CELSR3)	PF00002 ; PF00028 ; PF00008 ; PF16489 ; PF01825 ; PF00053 ; PF02210 More >>	28.723 (27/94)	7.21E-04
Thrombospondin-1 (THBS1)	PF00090 ; PF02412 ; PF05735 ; PF00093 More >>	31.193 (34/109)	3.00E-03
Click to Show/Hide the Information of Human Similarity Proteins

References

Top

REF 1

EGFL6 Regulates the Asymmetric Division, Maintenance, and Metastasis of ALDH+ Ovarian Cancer Cells. Cancer Res. 2016 Nov 1;76(21):6396-6409.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN