Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T28532
(Former ID: TTDI01572)
|
|||||
| Target Name |
Ribonuclease P protein (RPP)
|
|||||
| Synonyms |
Ribonuclease P protein
Click to Show/Hide
|
|||||
| Gene Name |
RPP14; RPP21
|
|||||
| Target Type |
Discontinued target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Psoriasis [ICD-11: EA90] | |||||
| Function |
Acts as a catalyst in the same way that a protein-based enzyme would. Its function is to cleave off an extra, or precursor, sequence of RNA on tRNA molecules.
Click to Show/Hide
|
|||||
| BioChemical Class |
Endoribonucleases
|
|||||
| UniProt ID | ||||||
| Sequence |
MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALP
LDILTYEEKTLSAILRICSSGLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRE LVLD Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | Etarotene | Drug Info | Discontinued in Phase 3 | Psoriasis vulgaris | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | Etarotene | Drug Info | [1] | |||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Retinoids inhibit human epidermal keratinocyte RNase P activity. Biol Chem. 2003 Mar;384(3):457-62. | |||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003576) | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.