Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T27999
(Former ID: TTDR00859)
|
|||||
| Target Name |
Bacterial Protective antigen (Bact pagA)
|
|||||
| Synonyms |
pagA; PA of Bacillus anthracis; Bacterial toxins translocating protein; Bacterial anthracis protective antigen; Bact PA83; Bact PA-83
Click to Show/Hide
|
|||||
| Gene Name |
Bact pagA
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Anthrax [ICD-11: 1B97] | |||||
| Function |
One of the three proteins composing the anthrax toxin, the agent which infects many mammalian species and that may cause death. PA binds to a receptor (ATR) in sensitive eukaryotic cells, thereby facilitating the translocation of the enzymatic toxin components, edema factor and lethal factor, across the target cell membrane. PA associated with LF causes death wheninjected, PA associated with EF produces edema. PA induces immunity to infection with anthrax.
Click to Show/Hide
|
|||||
| BioChemical Class |
Bacillus anthracis protective antigen
|
|||||
| UniProt ID | ||||||
| Sequence |
MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA
PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS DPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNA TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Raxibacumab | Drug Info | Approved | Anthrax | [1] | |
| Clinical Trial Drug(s) | [+] 3 Clinical Trial Drugs | + | ||||
| 1 | AVP-21D9 | Drug Info | Phase 1 | Bacillus anthracis infection | [2] | |
| 2 | IQ-DAA | Drug Info | Phase 1 | Bacillus anthracis infection | [3] | |
| 3 | Valortim | Drug Info | Phase 1 | Bacterial infection | [4] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | Anthrax vaccine | Drug Info | Discontinued in Phase 1 | Bacillus anthracis infection | [5] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 2 Modulator drugs | + | ||||
| 1 | Raxibacumab | Drug Info | [1] | |||
| 2 | IQ-DAA | Drug Info | [7] | |||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| PID Pathway | [+] 1 PID Pathways | + | ||||
| 1 | Cellular roles of Anthrax toxin | |||||
| Reactome | [+] 1 Reactome Pathways | + | ||||
| 1 | Uptake and function of anthrax toxins | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Modulation of innate and adaptive immune responses by tofacitinib (CP-690,550). J Immunol. 2011 Apr 1;186(7):4234-43. | |||||
| REF 2 | ClinicalTrials.gov (NCT01202695) Safety and Pharmacokinetics Study of Human Monoclonal Antibody (AVP-21D9). U.S. National Institutes of Health. | |||||
| REF 3 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020942) | |||||
| REF 4 | ClinicalTrials.gov (NCT01265745) Dose Escalation Study of Valortim (MDX-1303) Administered Intravenously (IV) in Healthy, Normal Subjects. U.S. National Institutes of Health. | |||||
| REF 5 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017549) | |||||
| REF 6 | Efficacy and Safety of AVP-21D9, an Anthrax Monoclonal Antibody, in Animal Models and Humans. Antimicrob Agents Chemother. 2014 July; 58(7): 3618-3625. | |||||
| REF 7 | Anti-toxin antibodies in prophylaxis and treatment of inhalation anthrax.Future Microbiol.2009 Feb;4(1):35-43. | |||||
| REF 8 | Phase I Study Evaluating the Safety and Pharmacokinetics of MDX-1303, a Fully Human Monoclonal Antibody against Bacillus anthracis Protective Antigen, in Healthy Volunteers. Clin Vaccine Immunol. 2011 December; 18(12): 2136-2142. | |||||
| REF 9 | Annual Reports in Medicinal Chemistry. Annette M. Doherty. 2005. Page(214). | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.