Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T26338
(Former ID: TTDR01158)
|
|||||
| Target Name |
Homeobox protein Hox-A7 (HOXA7)
|
|||||
| Synonyms |
HoxA7; Hox-1A; Hox 1.1; Homeobox protein Hox-1A; Homeobox protein Hox 1.1; HOX1A
Click to Show/Hide
|
|||||
| Gene Name |
HOXA7
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Function |
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Click to Show/Hide
|
|||||
| BioChemical Class |
Antp homeobox
|
|||||
| UniProt ID | ||||||
| Sequence |
MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSP
LYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIY PWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQN RRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDEEEEDEEE Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-regulating microRNAs | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Functional contribution of EEN to leukemogenic transformation by MLL-EEN fusion protein. Oncogene. 2004 Apr 22;23(19):3385-94. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.