Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T24979
(Former ID: TTDR01354)
|
|||||
Target Name |
Influenza NP messenger RNA (Influ NP mRNA)
|
|||||
Synonyms |
Influenza nucleoprotein (mRNA); Influenza nucleocapsid protein (mRNA)
Click to Show/Hide
|
|||||
Gene Name |
Influ NP mRNA
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
The encapsidated genomic RNA is termed the ribonucleoprotein (RNP) and serves as template for transcription and replication. The RNP needs to be localized in the host nucleus to start an infectious cycle, but is too large to diffuse through the nuclear pore complex. NP comprises at least 2 nuclear localization signals that are responsible for the active RNP import into the nucleus through cellular importin alpha/beta pathway. Later in the infection, nclear export of RNPs are mediated through viral proteins NEP interacting with M1 which binds nucleoproteins. It is possible that nucleoprotein binds directly host exportin-1/XPO1 and plays an active role in RNPs nuclear export. M1 interaction with RNP seems to hide nucleoprotein's nuclear localization signals. Soon after a virion infects a new cell, M1 dissociates from the RNP under acidification of the virion driven by M2 protein. Dissociation of M1 from RNP unmasks nucleoprotein's nuclear localization signals, targeting the RNP to the nucleus. Encapsidates the negative strand viral RNA, protecting it from nucleases.
Click to Show/Hide
|
|||||
BioChemical Class |
mRNA target
|
|||||
UniProt ID | ||||||
Sequence |
MASQGTKRSYEQMETGGERQNATEIRASVGRMVGGIGRFYIQMCTELKLSDQEGRLIQNS
ITIERMVLSAFDERRNRYLEEHPSAGKDPKKTGGPIYRRRDGKWVRELILYDKEEIRRIW RQANNGEDATAGLTHMMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAG AAIKGVGTMVMELIRMIKRGINDRNFWRGENGRRTRIAYERMCNILKGKFQTAAQKAMMD QVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCLPACVYGPAVASGYDFEREGYSLVG IDPFRLLQNSQVFSLIRPKENPAHKSQLVWMACHSAAFEDLRVSSFIRGTRVIPRGQLST RGVQIASNENVEAMDSTTLELRSRYWAIRTRSGGNTNQQRASAGQISVQPTFSVQRNLPF ERVTIMAAFKGNTEGRTSDMRTEIIRMMESARPEDVSFQGRGVFELSDEKATNPIVPSFD MSNEGSYFFGDNAEEYDN Click to Show/Hide
|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | US patent application no. 5,580,767, Inhibition of influenza viruses by antisense oligonucleotides. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.