Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T22415
(Former ID: TTDI02142)
|
|||||
Target Name |
Pseudomonas PcrV protein type III (Pseudo pcrV)
|
|||||
Synonyms |
Type III secretion protein PcrV; Pseudo Virulence-associated V antigen; Pseudo Low calcium response locus protein V; PcrV
Click to Show/Hide
|
|||||
Gene Name |
Pseudo pcrV
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 4 Target-related Diseases | + | ||||
1 | Cystic fibrosis [ICD-11: CA25] | |||||
2 | Medical/surgical procedure injury [ICD-11: PK80-PK81] | |||||
3 | Postoperative inflammation [ICD-11: 1A00-CA43] | |||||
4 | Glanders [ICD-11: 1B92] | |||||
Function |
Essential for cytotoxicity. Found both within the bacterial cytoplasm and localized extracellularly.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALA
WLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDV LQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYA VGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNF ATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | KB001A | Drug Info | Phase 2 | Infectious disease | [2] | |
2 | MEDI3902 | Drug Info | Phase 2 | Ventilator-associated pneumonia | [3] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 1 Inhibitor drugs | + | ||||
1 | KB001A | Drug Info | [4] |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. | |||||
REF 2 | ClinicalTrials.gov (NCT01695343) Study to Evaluate the Effect of KB001-A on Time-to-Need for Antibiotic Treatment. U.S. National Institutes of Health. | |||||
REF 3 | ClinicalTrials.gov (NCT02696902) Effort to Prevent Nosocomial Pneumonia Caused by Pseudomonas Aeruginosa in Mechanically Ventilated Subjects | |||||
REF 4 | KB001-A, a novel anti-inflammatory, found to be safe and well-tolerated in cystic fibrosis patients infected with Pseudomonas aeruginosa. J Cyst Fibros. 2018 Jul;17(4):484-491. | |||||
REF 5 | A multifunctional bispecific antibody protects against Pseudomonas aeruginosa. Sci Transl Med. 2014 Nov 12;6(262):262ra155. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.