Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T19414
(Former ID: TTDR01242)
|
|||||
| Target Name |
Fibrin (FG)
|
|||||
| Synonyms |
Fibrinogen (31-44)
Click to Show/Hide
|
|||||
| Gene Name |
FGA; FGB
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Bleeding disorder [ICD-11: GA20-GA21] | |||||
| 2 | Skin postprocedural disorder [ICD-11: EL8Y] | |||||
| Function |
A fibrous, non-globular protein involved in the clotting of blood. Formed by the action of the protease thrombin on fibrinogen which causes it to polymerize.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDW
NYKCPSGCRMKGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSA NNRDNTYNRVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSC RGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIKMKPVPDLVPGNFKSQ LQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTGSETESPRNPSSAGSWNSGSS GPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTW NPGSSERGSAGHWTSESSVSGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNV SPGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTK EVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTASTGKTFPGFFSPMLGEF VSETESRGSESGIFTNTKESSSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKS YKMADEAGSEADHEGTHSTKRGHAKSRPVRDCDDVLQTHPSGTQSGIFNIKLPGSSKIFS VYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQR GSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSH NNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENG VVWVSFRGADYSLRAVRMKIRPLVTQ Click to Show/Hide
|
|||||
| HIT2.0 ID | T81ILO | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 5 Approved Drugs | + | ||||
| 1 | Baquting | Drug Info | Approved | Bleeding disorder | [2] | |
| 2 | Beriplast-P | Drug Info | Approved | Wound healing | [2] | |
| 3 | Fibrinolysin | Drug Info | Approved | Wound healing | [2] | |
| 4 | TachoComb | Drug Info | Approved | Wound healing | [2], [3] | |
| 5 | Thrombin/fibrinogen matrix patch | Drug Info | Approved | Bleeding disorder | [2], [4] | |
| Clinical Trial Drug(s) | [+] 6 Clinical Trial Drugs | + | ||||
| 1 | Adhexil | Drug Info | Phase 3 | Injury | [5] | |
| 2 | Alfimeprase | Drug Info | Phase 3 | Peripheral vascular disease | [6] | |
| 3 | KUR-211 | Drug Info | Phase 2 | Ulcer | [7] | |
| 4 | KUR-212 | Drug Info | Phase 2 | Wound healing | [8] | |
| 5 | Plasmin | Drug Info | Phase 2 | Occlusive disease | [9] | |
| 6 | Recombinant batroxobin | Drug Info | Phase 2 | Blood forming organ disorder | [10] | |
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | EP-2104R | Drug Info | Discontinued in Phase 2 | Cardiovascular disease | [11] | |
| Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
| 1 | FX-107 | Drug Info | Preclinical | Dengue fever | [12] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| Modulator | [+] 12 Modulator drugs | + | ||||
| 1 | Baquting | Drug Info | [2], [13] | |||
| 2 | Beriplast-P | Drug Info | [2], [14] | |||
| 3 | Fibrinolysin | Drug Info | [2], [15] | |||
| 4 | TachoComb | Drug Info | [1], [2] | |||
| 5 | Thrombin/fibrinogen matrix patch | Drug Info | [2], [16] | |||
| 6 | Adhexil | Drug Info | [17] | |||
| 7 | Alfimeprase | Drug Info | [18] | |||
| 8 | KUR-211 | Drug Info | [19] | |||
| 9 | KUR-212 | Drug Info | [20] | |||
| 10 | Plasmin | Drug Info | [21] | |||
| 11 | Recombinant batroxobin | Drug Info | [22] | |||
| 12 | EP-2104R | Drug Info | [23] | |||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | FX-107 | Drug Info | [24] | |||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Pancreaticojejunostomy using a fibrin adhesive sealant (TachoComb) for the prevention of pancreatic fistula after pancreaticoduodenectomy. Hepatogastroenterology. 2011 Jan-Feb;58(105):187-91. | |||||
| REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
| REF 3 | ClinicalTrials.gov (NCT00290836) Assess Efficacy and Safety of TachoComb H vs. Standard Surgical Treatment (i.e. Suturing) in Patients Undergoing Prostatectomy (TC-017-AU). U.S. National Institutes of Health. | |||||
| REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4459). | |||||
| REF 5 | ClinicalTrials.gov (NCT00865488) Evaluation of Adhexil Safety and Efficacy in Prevention and/or Reduction of Adhesions in Gynecological Surgery. U.S. National Institutes of Health. | |||||
| REF 6 | ClinicalTrials.gov (NCT00338585) Study of Alfimeprase's Ability to Dissolve Blood Clots in the Leg and Help Prevent the Need for Surgery. U.S. National Institutes of Health. | |||||
| REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024804) | |||||
| REF 8 | ClinicalTrials.gov (NCT00471939) Safety and Efficacy of I-020502 in Meshed Skin Autografting. U.S. National Institutes of Health. | |||||
| REF 9 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021318) | |||||
| REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800028815) | |||||
| REF 11 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018915) | |||||
| REF 12 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023709) | |||||
| REF 13 | Baquting, enable our sales and marketing team to effectively promote our principal products and help to stimulate the sales of our other pharmaceuticals. | |||||
| REF 14 | Wound healing and degradation of the fibrin sealant Beriplast P following partial liver resection in rabbits. Wound Repair Regen. 2005 May-Jun;13(3):318-23. | |||||
| REF 15 | FIBRINOLYSIN, FIBRIN AND HYALINE MEMBRANES. Pediatrics. 1963 Nov;32:940-2. | |||||
| REF 16 | Fibrin sealant patch for repair of acute type a aortic dissection. J Card Surg. 2013 Nov;28(6):736-41. | |||||
| REF 17 | Evaluation of a fibrin preparation containing tranexamic acid (Adhexil) in a rabbit uterine horn model of adhesions with and without bleeding and in a model with two surgical loci. Fertil Steril. 2010 Mar 1;93(4):1045-51. | |||||
| REF 18 | Disulfide structure of alfimeprase: A recombinant analog of fibrolase. Protein Sci. 2001 June; 10(6): 1264-1267. | |||||
| REF 19 | Clinical pipeline report, company report or official report of Kuros. | |||||
| REF 20 | Clinical pipeline report, company report or official report of Kuros. | |||||
| REF 21 | ClinicalTrials.gov (NCT01014975) A Safety and Dose Finding Study of Plasmin (Human) Administered Into the Middle Cerebral Artery of Stroke Patients. U.S. National Institutes of Health. | |||||
| REF 22 | Functional characterization of recombinant batroxobin, a snake venom thrombin-like enzyme, expressed from Pichia pastoris. FEBS Lett. 2004 Jul 30;571(1-3):67-73. | |||||
| REF 23 | EP-2104R: a fibrin-specific gadolinium-Based MRI contrast agent for detection of thrombus. J Am Chem Soc. 2008 May 7;130(18):6025-39. | |||||
| REF 24 | FX-06, a fibrin-derived Bbeta15-42 peptide for the potential treatment of reperfusion injury following myocardial infarction. Curr Opin Investig Drugs. 2009 Sep;10(9):997-1003. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.