Target Information

Target General Information

Top

Target ID

T17552 (Former ID: TTDI00194)

Target Name

Serine/threonine-protein kinase 33 (STK33)

Synonyms

STK33

Click to Show/Hide

Gene Name

STK33

Target Type

Literature-reported target

[1]

Function

Serine/threonine protein kinase which phosphorylates VIME. May play a specific role in the dynamic behavior of the intermediate filament cytoskeleton by phosphorylation of VIME. Not essential for the survival of KRAS-dependent AML cell lines.

Click to Show/Hide

BioChemical Class

Kinase

UniProt ID

STK33_HUMAN

EC Number

EC 2.7.11.1

Sequence

MADSGLDKKSTKCPDCSSASQKDVLCVCSSKTRVPPVLVVEMSQTSSIGSAESLISLERK
KEKNINRDITSRKDLPSRTSNVERKASQQQWGRGNFTEGKVPHIRIENGAAIEEIYTFGR
ILGKGSFGIVIEATDKETETKWAIKKVNKEKAGSSAVKLLEREVNILKSVKHEHIIHLEQ
VFETPKKMYLVMELCEDGELKEILDRKGHFSENETRWIIQSLASAIAYLHNNDIVHRDLK
LENIMVKSSLIDDNNEINLNIKVTDFGLAVKKQSRSEAMLQATCGTPIYMAPEVISAHDY
SQQCDIWSIGVVMYMLLRGEPPFLASSEEKLFELIRKGELHFENAVWNSISDCAKSVLKQ
LMKVDPAHRITAKELLDNQWLTGNKLSSVRPTNVLEMMKEWKNNPESVEENTTEEKNKPS
TEEKLKSYQPWGNVPDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAE
IKGEMEKTPVTPSQGTATKYPAKSGALSRTKKKL

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues. The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021). Human Similarity Proteins Human Tissue Distribution

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.

The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021).

Human Similarity Proteins

Human Tissue Distribution

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Titin (TTN)		28.253 (76/269)	4.46E-28
Mixed lineage kinase 2 (MAP3K10)	PF07714 ; PF14604	32.524 (67/206)	1.45E-25
Ephrin type-A receptor 2 (EPHA2)	PF14575 ; PF01404 ; PF00041 ; PF07714 ; PF00536 More >>	30.159 (76/252)	1.36E-23
Mitogen-activated protein kinase kinase kinase 13 (MAP3K13)	PF07714	30.233 (78/258)	6.23E-23
Mitogen-activated protein kinase kinase kinase 12 (MAP3K12)	PF07714	30.337 (81/267)	4.73E-22
Serine/threonine-protein kinase B-raf (BRAF)	PF00130 ; PF07714 ; PF02196 More >>	28.626 (75/262)	4.78E-22
Ephrin type-A receptor 1 (EPHA1)	PF14575 ; PF01404 ; PF07699 ; PF00041 ; PF07714 ; PF00536 More >>	30.973 (70/226)	7.19E-22
Mixed lineage kinase 4 (MAP3K21)	PF07714 ; PF14604	31.222 (69/221)	1.03E-21
Ephrin type-A receptor 7 (EPHA7)	PF14575 ; PF01404 ; PF07699 ; PF00041 ; PF07714 ; PF00536 More >>	28.889 (65/225)	1.74E-21
Mixed lineage kinase 3 (MAP3K11)	PF07714 ; PF14604	29.612 (61/206)	6.63E-21
Tyrosine-protein kinase BRK (PTK6)	PF07714 ; PF00017 ; PF00018 More >>	30.435 (70/230)	1.51E-20
Ephrin type-A receptor 4 (EPHA4)	PF14575 ; PF01404 ; PF00041 ; PF07714 ; PF07647 More >>	28.889 (65/225)	1.57E-20
LIM domain kinase-2 (LIMK-2)	PF00412 ; PF00595 ; PF07714 More >>	28.505 (61/214)	3.30E-20
LIM domain kinase-1 (LIMK-1)	PF00412 ; PF00595 ; PF07714 More >>	27.273 (57/209)	4.34E-20
Ephrin type-A receptor 5 (EPHA5)	PF14575 ; PF01404 ; PF00041 ; PF07714 ; PF00536 More >>	29.694 (68/229)	7.20E-20
Proto-oncogene c-RAF (c-RAF)	PF00130 ; PF07714 ; PF02196 More >>	29.493 (64/217)	3.73E-19
Serine/threonine-protein kinase A-Raf (ARAF)	PF00130 ; PF07714 ; PF02196 More >>	27.308 (71/260)	4.35E-19
Tyrosine-protein kinase Tec (PSCTK4)	PF00779 ; PF00169 ; PF07714 ; PF00017 ; PF00018 More >>	25.856 (68/263)	4.52E-19
Insulin-like growth factor I receptor (IGF1R)	PF00757 ; PF07714 ; PF01030 More >>	28.631 (69/241)	7.75E-19
Fibroblast growth factor receptor 2 (FGFR2)	PF07679 ; PF13927 ; PF07714 More >>	27.304 (80/293)	9.16E-19
Ephrin type-B receptor 1 (EPHB1)	PF14575 ; PF01404 ; PF00041 ; PF07714 ; PF00536 More >>	28.444 (64/225)	1.59E-18
Kinase suppressor of Ras 2 (KSR2)	PF07714 ; PF13543 ; PF20406 More >>	26.609 (62/233)	1.70E-18
BDNF/NT-3 growth factors receptor (TrkB)	PF07679 ; PF13855 ; PF16920 ; PF01462 ; PF07714 More >>	26.141 (63/241)	1.92E-18
Focal adhesion kinase 1 (FAK)	PF00373 ; PF18038 ; PF03623 ; PF07714 More >>	30.435 (70/230)	2.45E-18
Insulin receptor-related protein (INSRR)	PF00757 ; PF07714 ; PF01030 More >>	25.448 (71/279)	4.01E-18
Ephrin type-A receptor 3 (EPHA3)	PF14575 ; PF01404 ; PF07699 ; PF00041 ; PF07714 ; PF07647 More >>	25.436 (73/287)	4.46E-18
Insulin receptor (INSR)	PF00757 ; PF17870 ; PF07714 ; PF01030 More >>	25.623 (72/281)	5.01E-18
Ephrin type-B receptor 4 (EPHB4)	PF14575 ; PF01404 ; PF07699 ; PF00041 ; PF07714 ; PF00536 More >>	28.444 (64/225)	5.67E-18
Ephrin type-B receptor 2 (EPHB2)	PF14575 ; PF01404 ; PF07699 ; PF00041 ; PF07714 ; PF00536 More >>	26.106 (59/226)	6.50E-18
Hematopoietic cell kinase (HCK)	PF07714 ; PF00017 ; PF00018 More >>	28.507 (63/221)	9.01E-18
Proto-oncogene c-Ret (RET)	PF00028 ; PF07714 ; PF17756 ; PF17812 ; PF17813 More >>	27.953 (71/254)	9.45E-18
Tyrosine-protein kinase FRK (FRK)	PF07714 ; PF00017 ; PF00018 More >>	29.279 (65/222)	1.03E-17
TGF-beta-activated kinase 1 (MAP3K7)	PF07714	28.436 (60/211)	1.18E-17
TYRO3 tyrosine kinase receptor (TYRO3)	PF00041 ; PF07679 ; PF07714 More >>	26.087 (66/253)	1.26E-17
TYK2 tyrosine kinase (TYK2)	PF18379 ; PF18377 ; PF17887 ; PF07714 More >>	29.612 (61/206)	1.56E-17
Ephrin type-A receptor 8 (EPHA8)	PF14575 ; PF01404 ; PF00041 ; PF07714 ; PF00536 More >>	31.111 (56/180)	2.17E-17
Erbb4 tyrosine kinase receptor (Erbb-4)	PF00757 ; PF14843 ; PF07714 ; PF01030 More >>	32.035 (74/231)	2.32E-17
Janus kinase 3 (JAK-3)	PF18379 ; PF18377 ; PF17887 ; PF07714 More >>	30.392 (62/204)	4.44E-17
Tyrosine-protein kinase TXK (TXK)	PF07714 ; PF00017 ; PF00018 More >>	28.000 (63/225)	8.06E-17
Ephrin type-B receptor 3 (EPHB3)	PF14575 ; PF01404 ; PF07699 ; PF00041 ; PF07714 ; PF00536 More >>	26.222 (59/225)	8.22E-17
Fibroblast growth factor receptor 1 (FGFR1)	PF07679 ; PF00047 ; PF07714 More >>	26.531 (78/294)	8.61E-17
Fibroblast growth factor receptor 3 (FGFR3)	PF07679 ; PF13927 ; PF07714 More >>	24.739 (71/287)	1.16E-16
Fibroblast growth factor receptor 4 (FGFR4)	PF07679 ; PF13927 ; PF07714 More >>	23.906 (71/297)	1.42E-16
Tyrosine-protein kinase Lyn (JTK8)	PF07714 ; PF00017 ; PF00018 More >>	26.244 (58/221)	1.66E-16
Proto-oncogene c-Fer (FER)	PF00611 ; PF07714 ; PF00017 More >>	27.511 (63/229)	1.86E-16
Ephrin type-A receptor 6 (EPHA6)	PF14575 ; PF01404 ; PF07699 ; PF00041 ; PF07714 ; PF00536 More >>	27.985 (75/268)	1.99E-16
Proto-oncogene c-Fes (FES)	PF07714 ; PF00017	28.511 (67/235)	2.43E-16
Tyrosine-protein kinase Srms (SRMS)	PF07714 ; PF00017	29.310 (68/232)	3.21E-16
Focal adhesion kinase 2 (PTK2B)	PF00373 ; PF18038 ; PF03623 ; PF07714 More >>	29.461 (71/241)	3.44E-16
Testis-specific kinase 2 (TESK2)	PF07714	23.755 (62/261)	6.10E-16
Neurotrophic tyrosine kinase ROR2 (ROR2)	PF01392 ; PF07679 ; PF00051 ; PF07714 More >>	24.269 (83/342)	8.01E-16
Ephrin type-A receptor 10 (EPHA10)	PF14575 ; PF01404 ; PF00041 ; PF07714 ; PF00536 More >>	27.074 (62/229)	9.16E-16
Megakaryocyte-associated tyrosine-protein kinase (MATK)	PF07714 ; PF00017 ; PF00018 More >>	28.319 (64/226)	1.01E-15
NT-3 growth factor receptor (TrkC)	PF07679 ; PF00047 ; PF13855 ; PF16920 ; PF01462 ; PF07714 More >>	24.490 (72/294)	1.18E-15
Kinase suppressor of Ras-1 (KSR1)	PF07714 ; PF13543 ; PF20406 More >>	24.911 (70/281)	3.15E-15
MLK-related kinase (MLTK)	PF07714 ; PF00536	29.126 (60/206)	3.36E-15
B lymphocyte kinase (BLK)	PF07714 ; PF00017 ; PF00018 More >>	29.596 (66/223)	4.18E-15
Tyrosine-protein kinase SYK (SYK)	PF07714 ; PF00017	26.457 (59/223)	4.23E-15
Discoidin domain-containing receptor 2 (DDR2)	PF00754 ; PF07714	26.459 (68/257)	4.70E-15
Muscle-specific kinase receptor (MUSK)	PF01392 ; PF07679 ; PF13927 ; PF07714 More >>	25.591 (65/254)	5.26E-15
Activated CDC42 kinase 1 (ACK-1)	PF09027 ; PF11555 ; PF07714 ; PF14604 More >>	28.319 (64/226)	6.79E-15
LCK tyrosine protein kinase (LCK)	PF07714 ; PF00017 ; PF00018 More >>	25.792 (57/221)	7.85E-15
Proto-oncogene c-Src (SRC)	PF07714 ; PF00017 ; PF00018 More >>	27.149 (60/221)	9.56E-15
Tropomyosin-related kinase A (TrkA)	PF13855 ; PF16920 ; PF07714 ; PF18613 More >>	25.105 (60/239)	1.09E-14
Macrophage-stimulating protein receptor (RON)	PF07714 ; PF01403 ; PF01833 More >>	25.564 (68/266)	1.29E-14
Epidermal growth factor receptor (EGFR)	PF00757 ; PF14843 ; PF07714 ; PF01030 More >>	29.870 (69/231)	1.46E-14
Ephrin type-B receptor 6 (EPHB6)	PF14575 ; PF01404 ; PF07699 ; PF00041 ; PF07714 ; PF07647 More >>	27.027 (60/222)	1.52E-14
Janus kinase 2 (JAK-2)	PF18379 ; PF18377 ; PF17887 ; PF07714 ; PF00017 More >>	28.708 (60/209)	1.78E-14
Tyrosine-protein kinase ABL1 (ABL)	PF08919 ; PF07714 ; PF00017 ; PF00018 More >>	25.000 (55/220)	1.84E-14
Renal carcinoma antigen NY-REN-64 (IRAK-4)	PF07714	26.316 (55/209)	1.86E-14
Testis-specific kinase 1 (TESK1)	PF07714	24.074 (52/216)	2.16E-14
Erbb2 tyrosine kinase receptor (HER2)	PF00757 ; PF14843 ; PF07714 ; PF01030 More >>	29.386 (67/228)	2.74E-14
Non-receptor tyrosine-protein kinase TNK1 (TNK1)	PF07714	27.556 (62/225)	4.90E-14
Fyn tyrosine protein kinase (FYN)	PF07714 ; PF00017 ; PF00018 More >>	26.549 (60/226)	5.44E-14
Serine/threonine-protein kinase TNNI3K (TNNI3K)	PF12796 ; PF13637 ; PF07714 More >>	29.717 (63/212)	6.09E-14
Yes tyrosine kinase (YES)	PF07714 ; PF00017 ; PF00018 More >>	26.697 (59/221)	6.93E-14
Tyrosine-protein kinase ABL2 (ABL2)	PF08919 ; PF07714 ; PF00017 ; PF00018 More >>	23.982 (53/221)	9.34E-14
Proto-oncogene c-Ros (ROS1)	PF00041 ; PF07714	25.455 (70/275)	1.12E-13
Erbb3 tyrosine kinase receptor (Erbb-3)	PF00757 ; PF14843 ; PF07714 ; PF01030 More >>	25.664 (58/226)	1.20E-13
Tyrosine-protein kinase Mer (MERTK)	PF00041 ; PF00047 ; PF07714 More >>	23.810 (60/252)	1.77E-13
T-cell-specific kinase (ITK)	PF00779 ; PF00169 ; PF07714 ; PF00017 ; PF00018 More >>	26.872 (61/227)	3.33E-13
Tyrosine-protein kinase Fgr (FGR)	PF07714 ; PF00017 ; PF00018 More >>	25.279 (68/269)	4.13E-13
Serine/threonine-protein kinase LMTK1 (AATK)	PF07714	26.182 (72/275)	5.47E-13
Tyrosine-protein kinase UFO (AXL)	PF00041 ; PF13927 ; PF07714 More >>	22.997 (66/287)	5.80E-13
Angiopoietin 1 receptor (TEK)	PF00041 ; PF10430 ; PF07714 More >>	25.758 (68/264)	8.19E-13
Tie-1 tyrosine kinase receptor (TIE1)	PF00041 ; PF00047 ; PF07714 More >>	26.829 (66/246)	9.28E-13
Neurotrophic tyrosine kinase ROR1 (ROR1)	PF01392 ; PF07679 ; PF00051 ; PF07714 More >>	24.000 (48/200)	1.04E-12
Receptor-interacting protein 1 (RIPK1)	PF00531 ; PF07714 ; PF12721 More >>	26.724 (62/232)	1.45E-12
Ankyrin repeat and protein kinase domain-containing protein 1 (ANKK1)	PF12796 ; PF13637 ; PF07714 More >>	27.230 (58/213)	2.13E-12
Janus kinase 1 (JAK-1)	PF18379 ; PF18377 ; PF17887 ; PF07714 More >>	26.442 (55/208)	2.57E-12
Proto-oncogene c-Met (MET)	PF07714 ; PF01437 ; PF01403 ; PF01833 More >>	24.201 (53/219)	2.87E-12
Tyrosine-protein kinase BTK (ATK)	PF00779 ; PF00169 ; PF07714 ; PF00017 ; PF00018 More >>	25.333 (57/225)	4.50E-12
Serine/threonine-protein kinase LMTK3 (LMTK3)	PF07714	25.847 (61/236)	6.77E-12
Tyrosine-protein kinase CSK (CSK)	PF07714 ; PF00017 ; PF00018 More >>	26.570 (55/207)	1.47E-11
Tyrosine-protein kinase ZAP-70 (ZAP-70)	PF07714 ; PF00017	24.670 (56/227)	1.70E-11
Atrial natriuretic peptide receptor B (NPR2)	PF01094 ; PF00211 ; PF07714 More >>	23.906 (71/297)	2.47E-11
TGF-beta receptor type II (TGFBR2)	PF08917 ; PF07714	28.163 (69/245)	2.71E-11
Inactive tyrosine-protein kinase 7 (PTK7)	PF07679 ; PF13927 ; PF07714 More >>	24.138 (56/232)	2.76E-11
Tyrosine-protein kinase BMX (BMX)	PF00779 ; PF00169 ; PF07714 ; PF00017 More >>	24.074 (65/270)	2.92E-11
Macrophage colony-stimulating factor 1 receptor (CSF1R)	PF00047 ; PF13927 ; PF07714 More >>	25.532 (48/188)	2.31E-10
Dual serine/threonine and tyrosine protein kinase (DSTYK)	PF07714	24.903 (64/257)	2.70E-10
Leukocyte receptor tyrosine kinase (LTK)	PF12810 ; PF07714	20.877 (100/479)	3.66E-10
Epithelial discoidin domain receptor 1 (DDR1)	PF00754 ; PF07714	24.645 (52/211)	4.00E-10
Tyrosine-protein kinase STYK1 (STYK1)	PF07714	24.537 (53/216)	4.08E-10
ALK tyrosine kinase receptor (ALK)	PF12810 ; PF00629 ; PF07714 More >>	21.941 (52/237)	6.17E-10
Mixed lineage kinase domain-like protein (MLKL)	PF07714	23.301 (48/206)	1.02E-09
Tyrosine-protein kinase Kit (KIT)	PF00047 ; PF07714	25.949 (41/158)	2.36E-09
Tyrosine-protein kinase RYK (RYK)	PF07714 ; PF02019	25.571 (56/219)	2.95E-09
Activin receptor-like kinase 2 (ALK-2)	PF01064 ; PF07714 ; PF08515 More >>	27.517 (82/298)	8.38E-09
Activin receptor-like kinase-1 (ACVRL1)	PF07714 ; PF08515	26.364 (58/220)	4.48E-08
Activin receptor type-1C (ACVR1C)	PF01064 ; PF07714 ; PF08515 More >>	27.602 (61/221)	4.53E-08
Bone morphogenetic protein receptor type-1A (BMPR1A)	PF01064 ; PF07714 ; PF08515 More >>	26.174 (78/298)	6.64E-08
Vascular endothelial growth factor receptor 3 (FLT-4)	PF07679 ; PF13927 ; PF07714 ; PF17988 More >>	28.846 (30/104)	1.58E-07
Retinal guanylyl cyclase 2 (GUCY2F)	PF01094 ; PF00211 ; PF07701 ; PF07714 More >>	24.912 (71/285)	1.74E-07
Vascular endothelial growth factor receptor 1 (FLT-1)	PF07679 ; PF00047 ; PF13927 ; PF07714 ; PF17988 More >>	30.000 (36/120)	1.76E-07
Serine/threonine-protein kinase LMTK2 (LMTK2)	PF07714	25.532 (36/141)	1.90E-07
Fms-like tyrosine kinase 3 (FLT-3)	PF00047 ; PF07714	26.667 (32/120)	2.25E-07
Platelet-derived growth factor receptor beta (PDGFRB)	PF07679 ; PF00047 ; PF13927 ; PF07714 More >>	26.667 (32/120)	2.86E-07
Vascular endothelial growth factor receptor 2 (KDR)	PF07679 ; PF13927 ; PF07714 ; PF17988 More >>	29.808 (31/104)	6.38E-07
Atrial natriuretic peptide receptor A (NPR1)	PF01094 ; PF00211 ; PF07714 More >>	21.523 (65/302)	7.81E-07
Platelet-derived growth factor receptor alpha (PDGFRA)	PF07679 ; PF07714	27.885 (29/104)	8.41E-07
Guanylyl cyclase C (GUCY2C)	PF00211 ; PF07714	25.668 (48/187)	1.16E-06
Bone morphogenetic protein receptor type-1B (BMPR1B)	PF01064 ; PF07714 ; PF08515 More >>	25.909 (57/220)	1.15E-04
Nuclear receptor-binding protein (NRBP1)	PF07714	24.797 (61/246)	1.69E-04
Inactive serine/threonine-protein kinase PLK5 (PLK5)		31.429 (22/70)	4.89E-04
Mitotic checkpoint serine/threonine-protein kinase BUB1 beta (BUB1B)	PF08311	23.387 (29/124)	1.00E-03
Click to Show/Hide the Information of Human Similarity Proteins


Note: If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.

Chemical Structure based Activity Landscape of Target

Top

References

Top

REF 1

STK33 kinase activity is nonessential in KRAS-dependent cancer cells. Cancer Res. 2011 Sep 1;71(17):5818-26.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN