Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T16578
(Former ID: TTDI00229)
|
|||||
Target Name |
Annexin A8 (ANXA8)
|
|||||
Synonyms |
Vascular anticoagulant-beta; VAC-beta; Annexin-8; Annexin VIII; ANX8
Click to Show/Hide
|
|||||
Gene Name |
ANXA8
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
Click to Show/Hide
|
|||||
BioChemical Class |
Annexin protein
|
|||||
UniProt ID | ||||||
Sequence |
MAWWKSWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIA
KSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEIL ASRTKNQLREIMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQGSRDDVSSFVDPGLAL QDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVFEEYEKIANKSIEDSIKSETHGSL EEAMLTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYG KTLSSMIMEDTSGDYKNALLSLVGSDP Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Annexin A8 Is a Prognostic Marker and Potential Therapeutic Target for Pancreatic Cancer. Pancreas. 2015 Jan;44(1):122-7. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.