Target Information

Target General Information

Top

Target ID

T08647 (Former ID: TTDI03177)

Target Name

Ephrin type-A receptor 6 (EPHA6)

Synonyms

HEK12; EPH-like kinase 12; EPH homology kinase 2; EK12; EHK2; EHK-2

Click to Show/Hide

Gene Name

EPHA6

Target Type

Literature-reported target

[1]

Function

The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells.

Click to Show/Hide

BioChemical Class

Kinase

UniProt ID

EPHA6_HUMAN

EC Number

EC 2.7.10.1

Sequence

MGGCEVREFLLQFGFFLPLLTAWPGDCSHVSNNQVVLLDTTTVLGELGWKTYPLNGWDAI
TEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGT
CKETFNLFYMESDESHGIKFKPNQYTKIDTIAADESFTQMDLGDRILKLNTEIREVGPIE
RKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSA
EERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHS
LTYMEATSVCQCEKGYFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSDTGGR
KDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNG
VSELSFSPKPFTAITVTTDQDAPSLIGVVRKDWASQNSIALSWQAPAFSNGAILDYEIKY
YEKEHEQLTYSSTRSKAPSVIITGLKPATKYVFHIRVRTATGYSGYSQKFEFETGDETSD
MAAEQGQILVIATAAVGGFTLLVILTLFFLITGRCQWYIKAKMKSEEKRRNHLQNGHLRF
PGIKTYIDPDTYEDPSLAVHEFAKEIDPSRIRIERVIGAGEFGEVCSGRLKTPGKREIPV
AIKTLKGGHMDRQRRDFLREASIMGQFDHPNIIRLEGVVTKRSFPAIGVEAFCPSFLRAG
FLNSIQAPHPVPGGGSLPPRIPAGRPVMIVVEYMENGSLDSFLRKHDGHFTVIQLVGMLR
GIASGMKYLSDMGYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEAAYTTTGGKIPI
RWTAPEAIAYRKFSSASDAWSYGIVMWEVMSYGERPYWEMSNQDVILSIEEGYRLPAPMG
CPASLHQLMLHCWQKERNHRPKFTDIVSFLDKLIRNPSALHTLVEDILVMPESPGEVPEY
PLFVTVGDWLDSIKMGQYKNNFVAAGFTTFDLISRMSIDDIRRIGVILIGHQRRIVSSIQ
TLRLHMMHIQEKGFHV

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function. Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006). Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database. The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017). Human Similarity Proteins Human Pathway Affiliation Biological Network Descriptors

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.

Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006).

Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.

The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017).

Human Similarity Proteins

Human Pathway Affiliation

Biological Network Descriptors

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Mixed lineage kinase 1 (MAP3K9)	PF00069 ; PF14604	29.697 (98/330)	2.24E-24
Serine/threonine-protein kinase Nek5 (NEK5)	PF00069	26.230 (80/305)	5.00E-20
Receptor-interacting serine/threonine-protein kinase 3 (RIPK3)	PF00069 ; PF12721	27.463 (92/335)	1.81E-17
Ribosomal protein S6 kinase alpha-6 (RSK6)	PF00069 ; PF00433	26.736 (77/288)	2.33E-16
Ribosomal protein S6 kinase alpha-1 (RSK1)	PF00069 ; PF00433	26.761 (76/284)	3.16E-16
Serine/threonine-protein kinase 26 (STK26)	PF00069	25.926 (84/324)	3.73E-16
Serine/threonine-protein kinase 33 (STK33)	PF00069	27.985 (75/268)	4.01E-16
Ribosomal protein S6 kinase alpha-2 (RSK2)	PF00069 ; PF00433	26.621 (78/293)	4.37E-16
Serine/threonine-protein kinase Nek4 (NEK4)	PF00069	25.763 (76/295)	5.36E-16
Serine/threonine-protein kinase Nek11 (NEK11)	PF00069	22.936 (75/327)	8.84E-16
Ribosomal protein S6 kinase alpha-3 (RSK3)	PF00069 ; PF00433	26.298 (76/289)	1.34E-15
Serine/threonine-protein kinase 24 (STK24)	PF00069	28.643 (57/199)	1.09E-14
MST-1 protein kinase (STK4)	PF11629 ; PF00069	25.692 (65/253)	3.26E-14
NIMA-related kinase 7 (NEK7)	PF00069	23.355 (71/304)	6.06E-14
PKC-delta-interacting protein kinase (RIPK4)	PF12796 ; PF00069	31.088 (60/193)	6.69E-14
Serine/threonine-protein kinase ULK2 (ULK2)	PF12063 ; PF00069	24.551 (82/334)	6.89E-14
Serine/threonine-protein kinase 3 (STK3)	PF11629 ; PF00069	24.595 (76/309)	1.12E-13
Serine/threonine-protein kinase Nek3 (NEK3)	PF00069	22.373 (66/295)	1.92E-13
Fused homolog (STK36)	PF13646 ; PF00069	24.444 (66/270)	2.00E-13
Calcium/calmodulin-dependent protein kinase type 1 (CAMK1)	PF00069	25.086 (73/291)	2.57E-13
NIMA-related kinase 1 (NEK1)	PF00069	23.473 (73/311)	3.42E-13
Serine/threonine-protein kinase PLK3 (PLK3)	PF00069 ; PF00659	32.000 (48/150)	4.77E-13
SIK family kinase 3 (SIK3)	PF00069	24.796 (91/367)	5.35E-13
Extracellular signal-regulated kinase 2 (ERK2)	PF00069	27.311 (65/238)	6.12E-13
Polo-like kinase 2 (PLK2)	PF00069 ; PF00659	29.121 (53/182)	9.44E-13
Cyclin-dependent kinase 13 (CDK13)	PF12330 ; PF00069	24.710 (64/259)	1.15E-12
Myosin light chain kinase 2 (MYLK2)	PF00069	23.755 (62/261)	1.26E-12
Apoptosis signal-regulating kinase 1 (MAP3K5)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	25.159 (79/314)	1.48E-12
Omphalocele kinase 1 (NUAK1)	PF00069	23.162 (63/272)	1.52E-12
Microtubule affinity regulating kinase 3 (MARK3)	PF02149 ; PF00069 ; PF00627 More >>	24.176 (66/273)	2.07E-12
Inhibitor of nuclear factor kappa-B kinase beta (IKKB)	PF18397 ; PF12179 ; PF00069 More >>	25.203 (62/246)	2.11E-12
Serine/threonine-protein kinase Nek8 (NEK8)	PF00069 ; PF00415	26.829 (55/205)	3.62E-12
NIMA-related kinase 2 (NEK2)	PF00069	23.841 (72/302)	3.89E-12
Serine/threonine-protein kinase MARK1 (MARK1)	PF02149 ; PF00069 ; PF00627 More >>	23.810 (65/273)	3.96E-12
Calcium/calmodulin-dependent protein kinase type 1G (CAMK1G)	PF00069	27.933 (50/179)	3.96E-12
Salt-inducible kinase 2 (SIK2)	PF00069	26.316 (65/247)	4.17E-12
Serine/threonine-protein kinase 25 (STK25)	PF00069	24.096 (80/332)	4.32E-12
Serine/threonine-protein kinase MARK2 (MARK2)	PF02149 ; PF00069 ; PF00627 More >>	24.176 (66/273)	5.54E-12
Serine/threonine-protein kinase ULK1 (ULK1)	PF12063 ; PF00069	24.815 (67/270)	5.81E-12
Stress-activated protein kinase 2b (p38 beta)	PF00069	25.000 (62/248)	6.90E-12
Serine/threonine-protein kinase NLK (NLK)	PF00069	27.490 (69/251)	6.98E-12
Ribosomal protein S6 kinase alpha-5 (RSK5)	PF00069 ; PF00433	28.358 (38/134)	9.99E-12
Cyclin-dependent kinase 12 (CDK12)	PF00069	22.018 (72/327)	1.04E-11
Ste-20-related kinase (STK39)	PF12202 ; PF00069	22.849 (77/337)	1.07E-11
Inhibitor of nuclear factor kappa-B kinase alpha (IKKA)	PF18397 ; PF12179 ; PF00069 More >>	23.577 (58/246)	1.36E-11
Polo-like kinase 1 (PLK1)	PF00069 ; PF00659	29.891 (55/184)	1.37E-11
Polo-like kinase 4 (PLK4)	PF00069 ; PF18190 ; PF18409 More >>	27.108 (45/166)	1.40E-11
5'-AMP-activated protein kinase catalytic subunit alpha-1 (PRKAA1)	PF16579 ; PF00069	24.415 (73/299)	1.60E-11
Serine/threonine-protein kinase tousled-like 2 (TLK2)	PF00069	23.200 (58/250)	1.75E-11
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2)	PF16579 ; PF00069	24.080 (72/299)	2.11E-11
Extracellular signal-regulated kinase 1 (ERK1)	PF00069	26.891 (64/238)	2.23E-11
Cyclin-dependent kinase 7 (CDK7)	PF00069	25.833 (62/240)	2.42E-11
ERK activator kinase 5 (MAP2K5)	PF00564 ; PF00069	28.804 (53/184)	2.62E-11
Tyrosine-protein kinase EIF2AK2 (p68)	PF00035 ; PF00069	22.034 (52/236)	2.79E-11
NIMA-related kinase 6 (NEK6)	PF00069	22.530 (57/253)	3.45E-11
MAP/microtubule affinity-regulating kinase 4 (MARK4)	PF02149 ; PF00069 ; PF00627 More >>	25.373 (68/268)	3.65E-11
Extracellular signal-regulated kinase 5 (ERK5)	PF00069	25.820 (63/244)	3.66E-11
Proto-oncogene serine/threonine-protein kinase mos (MOS)	PF00069	25.309 (82/324)	3.86E-11
Putative serine/threonine-protein kinase SIK1B (SIK1B)	PF00069	24.291 (60/247)	4.54E-11
Salt-inducible kinase 1 (SIK1)	PF00069	24.291 (60/247)	4.86E-11
Serine/threonine-protein kinase ICK (CILK1)	PF00069	23.488 (66/281)	5.45E-11
Aurora kinase C (AURKC)	PF00069	22.695 (64/282)	6.00E-11
Serine/threonine-protein kinase Nek9 (NEK9)	PF00069 ; PF00415	23.684 (90/380)	6.06E-11
Cytoplasmic DRAK1 (STK17A)	PF00069	29.530 (44/149)	6.45E-11
Protein kinase C alpha (PRKCA)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	28.966 (42/145)	6.93E-11
Stress-activated protein kinase 2a (p38 alpha)	PF00069	24.528 (65/265)	8.42E-11
Serine/threonine-protein kinase NIM1 (NIM1K)	PF00069	27.273 (81/297)	9.03E-11
Protein kinase C beta (PRKCB)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	28.276 (41/145)	9.50E-11
Serine/threonine-protein kinase PAK 6 (PAK6)	PF00786 ; PF00069	23.810 (65/273)	9.76E-11
Apoptosis signal-regulating kinase 2 (MAP3K6)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	32.335 (54/167)	1.17E-10
NUAK family SNF1-like kinase 2 (NUAK2)	PF00069	23.827 (66/277)	1.19E-10
Mitogen-activated protein kinase 13 (MAPK13)	PF00069	26.360 (63/239)	1.30E-10
Serine/threonine-protein kinase PAK 5 (PAK5)	PF00786 ; PF00069	24.691 (60/243)	1.51E-10
Putative 3-phosphoinositide-dependent protein kinase 2 (PDPK2P)	PF00069	22.131 (54/244)	1.87E-10
Leucine-rich repeat kinase 2 (LRRK2)	PF16095 ; PF12799 ; PF13855 ; PF00069 ; PF08477 More >>	24.123 (55/228)	1.98E-10
Bone morphogenetic protein receptor (BMPR2)	PF01064 ; PF00069	25.185 (68/270)	2.02E-10
Phosphoinositide dependent protein kinase-1 (PDPK1)	PF14593 ; PF00069	22.131 (54/244)	2.25E-10
Serine/threonine-protein kinase tousled-like 1 (TLK1)	PF00069	23.922 (61/255)	3.01E-10
Cyclin-dependent kinase 1 (CDK1)	PF00069	23.232 (69/297)	3.19E-10
MAPK-activated protein kinase 2 (MAPKAPK2)	PF00069	25.862 (60/232)	3.29E-10
Mitogen-activated protein kinase 15 (MAPK15)	PF00069	25.197 (64/254)	3.54E-10
Myosin light chain kinase family member 4 (MYLK4)	PF00069	24.180 (59/244)	3.79E-10
Mitogen-activated protein kinase kinase kinase 15 (MAP3K15)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	26.882 (50/186)	3.84E-10
Oxidative stress responsive 1 (OXSR1)	PF12202 ; PF00069	24.051 (76/316)	4.82E-10
Putative serine/threonine-protein kinase PRKY (PRKY)	PF00069	31.496 (40/127)	5.00E-10
Protein kinase C gamma (PRKCG)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	26.897 (39/145)	5.12E-10
Serine/threonine-protein kinase MAK (MAK)	PF00069	23.345 (67/287)	5.19E-10
Ribosomal protein S6 kinase beta-1 (S6K1)	PF00069 ; PF00433	23.322 (66/283)	5.56E-10
MAPK-activated protein kinase 3 (MAPKAPK3)	PF00069	25.949 (41/158)	6.32E-10
MAPK/ERK kinase kinase 3 (MAP3K3)	PF00564 ; PF00069	31.690 (45/142)	8.49E-10
Myosin light chain kinase 3 (MYLK3)	PF00069	26.471 (63/238)	1.01E-09
Testis-specific serine/threonine-protein kinase 1 (TSSK1B)	PF00069	28.877 (54/187)	1.10E-09
Testis-specific serine kinase 2 (TSSK2)	PF00069	29.221 (45/154)	1.46E-09
MAP kinase p38 (MAPK12)	PF00069	23.380 (83/355)	1.60E-09
Calcium/calmodulin-dependent protein kinase type 1D (CAMK1D)	PF00069	22.789 (67/294)	1.80E-09
Leucine-rich repeat serine/threonine-protein kinase 1 (LRRK1)	PF12796 ; PF16095 ; PF00069 ; PF08477 More >>	28.283 (56/198)	1.93E-09
Cyclin-dependent kinase 20 (CDK20)	PF00069	28.788 (38/132)	2.27E-09
ERK activator kinase 7 (MAP2K7)	PF00069	27.727 (61/220)	2.43E-09
TGF-beta-stimulated factor 1 (STK16)	PF00069	23.077 (66/286)	2.46E-09
STE20-related serine/threonine-protein kinase (SLK)	PF00069 ; PF12474	23.469 (69/294)	2.64E-09
MAPK/ERK kinase kinase 2 (MAP3K2)	PF00564 ; PF00069	31.469 (45/143)	2.90E-09
ERK activator kinase 1 (MEK1)	PF00069	33.333 (44/132)	2.91E-09
Inhibitor of nuclear factor kappa-B kinase subunit epsilon (IKBKE)	PF00069 ; PF18394 ; PF18396 More >>	25.296 (64/253)	2.97E-09
Protein kinase C theta (PRKCQ)	PF00130 ; PF00069 ; PF00433 More >>	27.972 (40/143)	3.02E-09
Death-associated protein kinase 1 (DAPK1)	PF00023 ; PF12796 ; PF13637 ; PF00531 ; PF00069 More >>	22.780 (59/259)	3.18E-09
Activin receptor type IB (ACVR1B)	PF01064 ; PF00069 ; PF08515 More >>	26.493 (71/268)	3.58E-09
Calcium/calmodulin-dependent protein kinase type 1B (PNCK)	PF00069	24.723 (67/271)	4.27E-09
MAPK/ERK kinase kinase 4 (MAP3K4)	PF19431 ; PF00069	28.261 (52/184)	4.33E-09
Serine/threonine-protein kinase 32A (STK32A)	PF00069	22.957 (59/257)	4.89E-09
cAMP-dependent protein kinase catalytic subunit PRKX (PRKX)	PF00069	30.370 (41/135)	5.87E-09
PAK-2 protein kinase (PAK2)	PF00786 ; PF00069	28.358 (38/134)	6.26E-09
Cyclin-dependent kinase 9 (CDK9)	PF00069	22.727 (55/242)	7.53E-09
Stress-activated protein kinase JNK1 (JNK1)	PF00069	27.004 (64/237)	8.15E-09
Ribosomal protein S6 kinase-related protein (RSKR)	PF00069	34.524 (29/84)	8.30E-09
PAK-1 protein kinase (PAK1)	PF00786 ; PF00069	28.467 (39/137)	9.36E-09
Protein kinase C epsilon (PRKCE)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	27.972 (40/143)	9.86E-09
Stress-activated protein kinase JNK3 (JNK3)	PF00069	26.160 (62/237)	1.04E-08
Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)	PF00069	30.698 (66/215)	1.20E-08
Ribosomal protein S6 kinase alpha-4 (RPS6KA4)	PF00069 ; PF00433	27.407 (37/135)	1.37E-08
Serine/threonine-protein kinase Sgk1 (SGK1)	PF00069 ; PF00433	23.891 (70/293)	1.40E-08
ERK activator kinase 2 (MEK2)	PF00069	31.200 (39/125)	1.42E-08
Serine/threonine-protein kinase PAK 3 (PAK3)	PF00786 ; PF00069	29.197 (40/137)	1.50E-08
Aurora kinase B (AURKB)	PF00069	22.535 (64/284)	1.53E-08
Death-associated protein kinase 2 (DAPK2)	PF00069	23.938 (62/259)	1.61E-08
Dual specificity mitogen-activated protein kinase kinase 6 (MAP2K6)	PF00069	29.688 (57/192)	1.99E-08
SPS1/STE20-related protein kinase YSK4 (YSK4)	PF00069	24.742 (48/194)	2.08E-08
Aurora kinase A (AURKA)	PF00069	23.166 (60/259)	2.20E-08
MAPK-activated protein kinase 5 (MAPKAPK5)	PF00069	28.409 (50/176)	2.20E-08
Cyclin-dependent kinase 11A (CDK11A)	PF00069	26.141 (63/241)	2.32E-08
Hormonally up-regulated neu tumor-associated kinase (HUNK)	PF00069	25.498 (64/251)	2.36E-08
Maternal embryonic leucine zipper kinase (MELK)	PF02149 ; PF00069	27.481 (36/131)	2.79E-08
Stress-activated protein kinase JNK2 (JNK2)	PF00069	26.383 (62/235)	3.01E-08
Cyclin-dependent kinase 11B (CDK11B)	PF00069	25.833 (62/240)	3.33E-08
TGF-beta receptor type I (TGFBR1)	PF01064 ; PF00069 ; PF08515 More >>	25.088 (71/283)	3.83E-08
MAPK/ERK kinase kinase 1 (MAP3K1)	PF00069	20.784 (53/255)	4.00E-08
Protein kinase C eta type (PRKCH)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	24.400 (61/250)	4.20E-08
Serine/threonine-protein kinase Nek10 (NEK10)	PF00069	22.280 (43/193)	4.65E-08
Serine/threonine-protein kinase 10 (STK10)	PF00069 ; PF12474	23.022 (64/278)	5.46E-08
Death-associated protein kinase 3 (DAPK3)	PF00069	23.664 (62/262)	5.59E-08
Protein kinase C delta (PRKCD)	PF00130 ; PF00069 ; PF00433 More >>	25.175 (36/143)	5.63E-08
Cyclin-dependent kinase 3 (CDK3)	PF00069	23.529 (56/238)	5.68E-08
Myosin-IIIa (MYO3A)	PF00612 ; PF00063 ; PF00069 More >>	22.059 (75/340)	5.77E-08
PAK-4 protein kinase (PAK4)	PF00786 ; PF00069	23.868 (58/243)	5.85E-08
RAC-alpha serine/threonine-protein kinase (AKT1)	PF00169 ; PF00069 ; PF00433 More >>	30.400 (38/125)	6.08E-08
RAC-gamma serine/threonine-protein kinase (AKT3)	PF00169 ; PF00069 ; PF00433 More >>	29.032 (36/124)	6.34E-08
cAMP-dependent protein kinase catalytic subunit gamma (PRKACG)	PF00069	20.979 (60/286)	6.35E-08
Serine/threonine-protein kinase H1 (PSKH1)	PF00069	26.316 (40/152)	6.70E-08
Cyclin-dependent kinase 2 (CDK2)	PF00069	22.581 (56/248)	7.28E-08
Cyclin-dependent kinase-like 4 (CDKL4)	PF00069	23.361 (57/244)	7.95E-08
Checkpoint kinase-1 (CHK1)	PF00069	34.694 (34/98)	8.03E-08
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A)	PF08332 ; PF00069	22.180 (59/266)	8.20E-08
Titin (TTN)		26.842 (51/190)	8.43E-08
Doublecortin-like kinase 1 (DCLK1)	PF03607 ; PF00069	23.554 (57/242)	1.01E-07
TRAF2 and NCK interacting kinase (TNIK)	PF00780 ; PF00069	29.487 (46/156)	1.06E-07
Serine/threonine-protein kinase TAO2 (TAOK2)	PF00069	24.151 (64/265)	1.30E-07
Calcium/calmodulin-dependent protein kinase type II subunit delta (CAMK2D)	PF08332 ; PF00069	22.472 (60/267)	1.32E-07
Calcium/calmodulin-dependent protein kinase type II subunit beta (CAMK2B)	PF08332 ; PF00069	25.806 (32/124)	1.43E-07
Serine/threonine-protein kinase Sgk2 (SGK2)	PF00069 ; PF00433	23.569 (70/297)	1.47E-07
Cyclin-dependent kinase-like 2 (CDKL2)	PF00069	25.207 (61/242)	1.54E-07
MEK kinase kinase 1 (MAP4K1)	PF00780 ; PF00069	26.020 (51/196)	1.65E-07
Citron Rho-interacting kinase (CIT)	PF00780 ; PF00169 ; PF00069 More >>	26.230 (48/183)	1.90E-07
Calcium/calmodulin-dependent protein kinase type II subunit gamma (CAMK2G)	PF08332 ; PF00069	21.429 (57/266)	2.01E-07
RAC-beta serine/threonine-protein kinase (AKT2)	PF00169 ; PF00069 ; PF00433 More >>	27.389 (43/157)	2.04E-07
Microtubule-associated serine/threonine-protein kinase 2 (MAST2)	PF08926 ; PF17820 ; PF00069 More >>	28.058 (39/139)	2.23E-07
Cyclin-dependent kinase 5 (CDK5)	PF00069	25.556 (69/270)	2.29E-07
cAMP-dependent protein kinase catalytic subunit alpha (PRKACA)	PF00069	23.874 (53/222)	2.70E-07
Mitogen-activated protein kinase 6 (MAPK6)	PF00069	24.757 (51/206)	2.99E-07
Serine/threonine-protein kinase 17B (STK17B)	PF00069	25.503 (38/149)	3.10E-07
SNF-related serine/threonine-protein kinase (SNRK)	PF00069	19.529 (58/297)	3.27E-07
CaM-kinase IV kinase (CAMKK1)	PF00069	31.746 (40/126)	3.84E-07
Cyclin-dependent kinase 6 (CDK6)	PF00069	22.000 (55/250)	3.85E-07
Ribosomal protein S6 kinase beta-2 (RPS6KB2)	PF00069 ; PF00433	25.503 (38/149)	4.01E-07
Eukaryotic translation initiation factor 2-alpha kinase 1 (EIF2AK1)	PF00069	26.415 (42/159)	4.02E-07
Microtubule-associated serine/threonine-protein kinase 4 (MAST4)	PF08926 ; PF17820 ; PF02163 ; PF00069 More >>	28.777 (40/139)	4.65E-07
PRKR-like endoplasmic reticulum kinase (PERK)	PF00069	30.612 (30/98)	4.77E-07
TAO kinase 1 (TAOK1)	PF00069	25.940 (69/266)	5.37E-07
Yet another novel kinase 2 (STK32B)	PF00069	23.308 (62/266)	5.60E-07
Cyclin-dependent kinase 10 (CDK10)	PF00069	22.519 (59/262)	5.79E-07
Testis-specific serine/threonine-protein kinase 6 (TSSK6)	PF00069	28.022 (51/182)	5.82E-07
Microtubule-associated serine/threonine-protein kinase 3 (MAST3)	PF08926 ; PF17820 ; PF02163 ; PF00069 More >>	28.058 (39/139)	5.90E-07
Serine/threonine kinase-like domain-containing protein STKLD1 (STKLD1)	PF00069	32.990 (32/97)	5.91E-07
Microtubule-associated serine/threonine-protein kinase 1 (MAST1)	PF08926 ; PF17820 ; PF00069 More >>	28.058 (39/139)	6.19E-07
Serine/threonine-protein kinase D2 (PRKD2)	PF00130 ; PF00069	22.000 (55/250)	6.45E-07
Cyclin-dependent kinase 4 (CDK4)	PF00069	30.435 (28/92)	6.81E-07
Misshapen-like kinase 1 (MINK1)	PF00780 ; PF00069	29.710 (41/138)	7.01E-07
Testis-specific serine/threonine-protein kinase 3 (TSSK3)	PF00069	22.000 (66/300)	7.35E-07
BR serine/threonine kinase 1 (BRSK1)	PF00069	20.388 (63/309)	7.79E-07
Serine/threonine-protein kinase PDIK1L (PDIK1L)	PF00069	22.481 (58/258)	7.86E-07
Serine/threonine-protein kinase H2 (PSKH2)	PF00069	23.322 (66/283)	8.99E-07
cAMP-dependent protein kinase catalytic subunit beta (PRKACB)	PF00069	24.138 (42/174)	9.08E-07
MEK kinase kinase 3 (MAP4K3)	PF00780 ; PF00069	22.291 (72/323)	9.42E-07
NF-kappa-B-activating kinase (TBK1)	PF00069 ; PF18394 ; PF18396 More >>	23.715 (60/253)	1.03E-06
Cyclin-dependent kinase-like 5 (CDKL5)	PF00069	23.643 (61/258)	1.18E-06
Cyclin-dependent kinase 18 (CDK18)	PF00069	23.140 (56/242)	1.19E-06
Activin receptor type IIA (ACVR2A)	PF01064 ; PF00069	28.676 (39/136)	1.25E-06
Cyclin-dependent kinase 19 (CDK19)	PF00069	21.824 (67/307)	1.34E-06
Cyclin-dependent kinase 17 (CDK17)	PF12330 ; PF00069	21.399 (52/243)	1.34E-06
Cyclin-dependent kinase 14 (CDK14)	PF00069	20.763 (49/236)	1.44E-06
Doublecortin-like kinase 2 (DCLK2)	PF03607 ; PF00069	23.551 (65/276)	1.45E-06
Mitogen-activated protein kinase 4 (MAPK4)	PF00069	22.772 (46/202)	1.66E-06
Serine/threonine-protein kinase MRCK beta (CDC42BPB)	PF00130 ; PF00780 ; PF08826 ; PF15796 ; PF00069 More >>	24.204 (38/157)	1.73E-06
TAO kinase 3 (TAOK3)	PF00069	23.050 (65/282)	1.80E-06
Protein kinase D (PRKD1)	PF00130 ; PF00169 ; PF00069 More >>	22.000 (55/250)	1.87E-06
Myosin-IIIb (MYO3B)	PF00612 ; PF00063 ; PF00069 More >>	29.825 (51/171)	1.91E-06
Serine/threonine-protein kinase Sgk3 (SGK3)	PF00069 ; PF00433 ; PF00787 More >>	36.082 (35/97)	2.00E-06
MEK kinase kinase 4 (MAP4K4)	PF00780 ; PF00069	29.710 (41/138)	2.10E-06
Phosphorylase kinase testis gamma 2 (PHKG2)	PF00069	24.375 (39/160)	2.15E-06
Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform (PHKG1)	PF00069	25.949 (41/158)	2.32E-06
Glycogen synthase kinase-3 alpha (GSK-3A)	PF00069	26.190 (66/252)	2.37E-06
Serine/threonine-protein kinase D3 (PRKD3)	PF00130 ; PF00169 ; PF00069 More >>	22.441 (57/254)	2.50E-06
Serine/threonine-protein kinase pim-2 (PIM2)	PF00069	24.862 (45/181)	2.80E-06
Mitogen-activated protein kinase kinase kinase kinase 5 (MAP4K5)	PF00780 ; PF00069	28.226 (35/124)	3.15E-06
BR serine/threonine kinase 2 (BRSK2)	PF00069	23.129 (34/147)	3.39E-06
CDC42 binding protein kinase alpha (DMPK-like alpha)	PF00130 ; PF00780 ; PF08826 ; PF15796 ; PF00069 ; PF00433 More >>	24.528 (39/159)	3.77E-06
Unc-51 like kinase 3 (ULK3)	PF04212 ; PF00069	24.812 (33/133)	3.84E-06
Serine/threonine-protein kinase greatwall (MASTL)	PF00069	35.526 (27/76)	4.04E-06
Protein kinase C zeta (PRKCZ)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	26.154 (51/195)	4.17E-06
Calcium/calmodulin-dependent protein kinase type IV (CAMK4)	PF00069	27.007 (37/137)	4.82E-06
Cyclin-dependent kinase 15 (CDK15)	PF00069	21.457 (53/247)	5.34E-06
Nik-related protein kinase (NRK)	PF00780 ; PF00069	28.221 (46/163)	6.50E-06
Glycogen synthase kinase-3 beta (GSK-3B)	PF00069	26.721 (66/247)	7.53E-06
STE20-related kinase adapter protein alpha (STRADA)	PF00069	25.625 (41/160)	7.62E-06
IL-1 receptor-associated kinase 1 (IRAK1)	PF00531 ; PF00069	21.013 (83/395)	7.92E-06
Serine/threonine-protein kinase Chk2 (RAD53)	PF00498 ; PF00069	27.891 (41/147)	8.05E-06
IL-1 receptor-associated kinase 3 (IRAK3)	PF00531 ; PF00069	21.317 (68/319)	8.88E-06
Cyclin-dependent kinase-like 3 (CDKL3)	PF00069	24.096 (60/249)	9.48E-06
Endoplasmic reticulum to nucleus signaling 1 (ERN1)	PF00069 ; PF06479	25.581 (33/129)	1.01E-05
MAP kinase signal-integrating kinase 2 (MKNK2)	PF00069	20.532 (54/263)	1.13E-05
Serine/threonine-protein kinase MRCK gamma (CDC42BPG)	PF00130 ; PF00780 ; PF08826 ; PF00069 More >>	24.084 (46/191)	1.34E-05
Serine/threonine-protein kinase Kist (UHMK1)	PF00069 ; PF00076	34.615 (36/104)	1.39E-05
Protein kinase C iota (PRKCI)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	29.167 (28/96)	1.41E-05
Serine/threonine-protein kinase STK11 (STK11)	PF00069	27.500 (44/160)	1.50E-05
Cyclin-dependent kinase-like 1 (CDKL1)	PF00069	23.651 (57/241)	1.65E-05
Anti-mullerian hormone II receptor (AMHR2)	PF00069	24.837 (38/153)	1.84E-05
MEK kinase kinase 2 (MAP4K2)	PF00780 ; PF00069	22.672 (56/247)	1.86E-05
Serine/threonine-protein kinase pim-1 (PIM1)	PF00069	23.099 (79/342)	2.80E-05
Eukaryotic translation initiation factor 2-alpha kinase 4 (EIF2AK4)	PF12745 ; PF00069 ; PF05773 ; PF13393 More >>	26.207 (38/145)	3.52E-05
G protein-coupled receptor kinase 6 (GRK6)	PF00069 ; PF00615	25.899 (36/139)	3.59E-05
Dual specificity mitogen-activated protein kinase kinase 4 (MAP2K4)	PF00069	26.203 (49/187)	3.75E-05
Cyclin-dependent kinase 16 (CDK16)	PF12330 ; PF00069	22.984 (57/248)	3.75E-05
Serine/threonine-protein kinase cot (COT)	PF00069	24.044 (44/183)	4.61E-05
Serine/threonine-protein kinase ULK4 (ULK4)	PF00069	25.161 (39/155)	4.79E-05
Doublecortin-like kinase 3 (DCLK3)	PF00069	23.810 (30/126)	4.87E-05
G protein-coupled receptor kinase 4 (GRK4)	PF00069 ; PF00615	26.496 (31/117)	5.19E-05
Serine/threonine-protein kinase NIK (MAP3K14)	PF00069	28.082 (41/146)	5.79E-05
Laminin subunit alpha-5 (LAMA5)	PF00052 ; PF00053 ; PF00054 ; PF02210 ; PF06008 ; PF06009 ; PF00055 More >>	27.273 (39/143)	6.84E-05
Tau-tubulin kinase 2 (TTBK2)	PF00069	23.923 (50/209)	6.87E-05
Activin receptor type IIB (ACVR2B)	PF01064 ; PF00069	25.352 (36/142)	7.58E-05
Protein kinase G2 (PRKG2)	PF00027 ; PF00069	25.954 (34/131)	7.81E-05
Beta-adrenergic receptor kinase 2 (ADRBK2)	PF00169 ; PF00069 ; PF00615 More >>	24.638 (34/138)	7.82E-05
Triple functional domain protein (TRIO)	PF00650 ; PF07679 ; PF00169 ; PF00069 ; PF00621 ; PF16609 ; PF00018 ; PF00435 More >>	28.161 (49/174)	7.95E-05
PDZ binding kinase (PBK)	PF00069	23.973 (35/146)	8.86E-05
Serine/threonine-protein kinase WNK4 (WNK4)	PF12202 ; PF00069	23.607 (72/305)	1.02E-04
NDR2 protein kinase (STK38L)	PF00069 ; PF00433	21.739 (35/161)	1.08E-04
Protein kinase G1 (PRKG1)	PF00027 ; PF16808 ; PF00069 More >>	27.083 (26/96)	1.16E-04
Rho-associated protein kinase 2 (ROCK2)	PF00069 ; PF08912	25.175 (36/143)	1.32E-04
CaM kinase-like vesicle-associated protein (CAMKV)	PF00069	23.228 (59/254)	1.52E-04
Membrane-associated kinase (PKMYT1)	PF00069	29.060 (34/117)	1.55E-04
Rho-associated protein kinase 1 (ROCK1)	PF00069 ; PF08912	25.175 (36/143)	1.92E-04
Beta-adrenergic receptor kinase 1 (ADRBK1)	PF00169 ; PF00069 ; PF00615 More >>	24.638 (34/138)	2.21E-04
Calmodulin-dependent kinase II (CAMKK2)	PF00069	27.723 (28/101)	2.26E-04
G protein-coupled receptor kinase 5 (GRK5)	PF00069 ; PF00615	21.176 (54/255)	2.32E-04
TBC domain-containing protein kinase-like protein (TBCK)	PF00069 ; PF00566 ; PF00581 More >>	26.761 (38/142)	2.34E-04
Striated muscle preferentially expressed protein kinase (SPEG)	PF07679 ; PF00069 ; PF16650 More >>	25.926 (28/108)	2.90E-04
Serine/threonine-protein kinase/endoribonuclease IRE2 (ERN2)	PF00069 ; PF06479	30.597 (41/134)	3.04E-04
Serine/threonine-protein kinase 32C (STK32C)	PF00069	22.791 (49/215)	3.46E-04
Serine/threonine-protein kinase SBK2 (SBK2)	PF00069	31.313 (31/99)	3.53E-04
Homeodomain-interacting protein kinase 3 (HIPK3)	PF00069	27.778 (35/126)	5.14E-04
PAS domain-containing serine/threonine-protein kinase (PASK)	PF13426 ; PF00069	26.923 (28/104)	5.16E-04
MAPK/MAK/MRK overlapping kinase (MOK)	PF00069	32.258 (30/93)	5.39E-04
STE20-related kinase adapter protein beta (STRADB)	PF00069	20.822 (76/365)	5.43E-04
Protein kinase N2 (PKN2)	PF02185 ; PF00069 ; PF00433 More >>	28.671 (41/143)	6.55E-04
Protein kinase N1 (PKN1)	PF02185 ; PF00069 ; PF00433 More >>	27.972 (40/143)	1.00E-03
SCY1-like protein 2 (SCYL2)	PF00069	28.333 (34/120)	1.00E-03
Rhodopsin kinase GRK7 (GRK7)	PF00069 ; PF00615	28.571 (28/98)	1.00E-03
Homeodomain-interacting protein kinase 1 (HIPK1)	PF00069	28.846 (45/156)	1.00E-03
Cyclin-dependent kinase 8 (CDK8)	PF00069	21.181 (61/288)	2.00E-03
PIM-3 protein kinase (PIM3)	PF00069	24.506 (62/253)	2.00E-03
Rhodopsin kinase GRK1 (GRK1)	PF00069 ; PF00615	26.087 (24/92)	2.00E-03
NDR1 protein kinase (STK38)	PF00069 ; PF00433	20.513 (32/156)	2.00E-03
Protein kinase N3 (PKN3)	PF02185 ; PF00069 ; PF00433 More >>	23.860 (68/285)	2.00E-03
Myotonin-protein kinase (DMPK)	PF08826 ; PF00069	24.684 (39/158)	3.00E-03
Homeodomain interacting protein kinase 2 (HIPK2)	PF00069	28.205 (44/156)	3.00E-03
Testis-specific serine/threonine-protein kinase 4 (TSSK4)	PF00069	18.553 (59/318)	4.00E-03
Serine/threonine-protein kinase WNK2 (WNK2)	PF12202 ; PF00069	23.767 (53/223)	4.00E-03
Interleukin-1 receptor-associated kinase-like 2 (IRAK2)	PF00531 ; PF00069	25.781 (33/128)	5.00E-03
Peripheral plasma membrane protein CASK (CASK)	PF00625 ; PF02828 ; PF00595 ; PF00069 ; PF00018 More >>	23.022 (32/139)	5.00E-03
Click to Show/Hide the Information of Human Similarity Proteins

KEGG Pathway	Pathway ID	Affiliated Target	Pathway Map
Axon guidance	hsa04360	Affiliated Target
Class: Organismal Systems => Development and regeneration	Pathway Hierarchy

Degree	2	Degree centrality	2.15E-04	Betweenness centrality	8.00E-07
Closeness centrality	1.83E-01	Radiality	1.31E+01	Clustering coefficient	0.00E+00
Neighborhood connectivity	9.50E+00	Topological coefficient	7.08E-01	Eccentricity	13
Download	Click to Download the Full PPI Network of This Target

Chemical Structure based Activity Landscape of Target

Top

Target Poor or Non Binders

Top

Target Poor or Non Binders

Target Poor or Non Binders Info

References

Top

REF 1

Amino acid conjugates of lithocholic acid as antagonists of the EphA2 receptor. J Med Chem. 2013 Apr 11;56(7):2936-47.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN