Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T00039
(Former ID: TTDC00335)
|
|||||
Target Name |
CTGF messenger RNA (CTGF mRNA)
|
|||||
Synonyms |
Long (mRNA); Insulin-like growth factor-binding protein 8 (mRNA); IGFBP8 (mRNA); IGFBP-8 (mRNA); IGF-binding protein 8 (mRNA); IBP-8 (mRNA); Hypertrophic chondrocyte-specific protein 24 (mRNA); HCS24 (mRNA); Connective tissue growth factor (mRNA); CCN2 (mRNA); CCN family member 2 (mRNA)
Click to Show/Hide
|
|||||
Gene Name |
CTGF
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Fibrosis [ICD-11: GA14-GC01] | |||||
Function |
Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. Major connective tissue mitoattractant secreted by vascular endothelial cells.
Click to Show/Hide
|
|||||
BioChemical Class |
mRNA target
|
|||||
UniProt ID | ||||||
Sequence |
MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | EXC 001 | Drug Info | Phase 2 | Fibrosis | [1] |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
1 | Hippo signaling pathway | |||||
NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
1 | TGF_beta_Receptor Signaling Pathway | |||||
PID Pathway | [+] 2 PID Pathways | + | ||||
1 | amb2 Integrin signaling | |||||
2 | TGF-beta receptor signaling | |||||
Reactome | [+] 2 Reactome Pathways | + | ||||
1 | PPARA activates gene expression | |||||
2 | YAP1- and WWTR1 (TAZ)-stimulated gene expression | |||||
WikiPathways | [+] 4 WikiPathways | + | ||||
1 | Hair Follicle Development: Cytodifferentiation (Part 3 of 3) | |||||
2 | Hair Follicle Development: Induction (Part 1 of 3) | |||||
3 | Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) | |||||
4 | YAP1- and WWTR1 (TAZ)-stimulated gene expression |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Clinical pipeline report, company report or official report of ISIS Pharmaceuticals (2011). |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.